StarFunc result for job id Q9UJU2

User Input

>input (399 residues)
MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNE
SEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNM
NNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNS
KQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMS
RFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIK
KPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHM
QLYPGWSARDNYGKKKKRKREKLQESASGTGPRMTAAYI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UJU2	0.999	0.999	1.874E-53	399	1.000	1.000	Q9UJU2.pdb.gz	LEF1_HUMAN Lymphoid enhancer-binding factor 1 OS=Homo sapiens OX=9606 GN=LEF1 PE=1 SV=1
2	AFDB:O93345	0.249	0.266	3.150E-43	369	0.875	0.946	O93345.pdb.gz	O93345_CHICK Lymphiod enhancer binding factor 1 OS=Gallus gallus OX=9031 GN=Lef-1 PE=2 SV=1
3	AFDB:F1Q7T6	0.215	0.142	6.234E-26	610	0.617	0.403	F1Q7T6.pdb.gz
4	AFDB:A0A2R8Q786	0.302	0.204	1.808E-25	630	0.632	0.400	A0A2R8Q786.pdb.gz
5	AFDB:Q9HCS4	0.282	0.199	6.830E-24	588	0.566	0.384	Q9HCS4.pdb.gz	TF7L1_HUMAN Transcription factor 7-like 1 OS=Homo sapiens OX=9606 GN=TCF7L1 PE=1 SV=1
6	AFDB:Q00417	0.311	0.300	3.160E-21	419	0.484	0.461	Q00417.pdb.gz	TCF7_MOUSE Transcription factor 7 OS=Mus musculus OX=10090 GN=Tcf7 PE=1 SV=2
7	AFDB:Q9U1H0	0.187	0.044	1.245E-3	1832	0.201	0.044	Q9U1H0.pdb.gz	CIC_DROME Putative transcription factor capicua OS=Drosophila melanogaster OX=7227 GN=cic PE=1 SV=2
8	AFDB:P54277	0.169	0.076	1.600E-3	932	0.123	0.053	P54277.pdb.gz	PMS1_HUMAN PMS1 protein homolog 1 OS=Homo sapiens OX=9606 GN=PMS1 PE=1 SV=1
9	PDB:1j5nA	0.158	0.598	2.015E-2	93	0.050	0.215	1j5nA.pdb.gz	The S. cerevisiae architectural HMGB protein NHP6A complexed with DNA: DNA and protein conformational changes upon binding
10	AFDB:Q8CGW4	0.204	0.109	4.706E-2	782	0.193	0.098	Q8CGW4.pdb.gz	SOX30_MOUSE Transcription factor SOX-30 OS=Mus musculus OX=10090 GN=Sox30 PE=1 SV=1
11	AFDB:O42967	0.085	0.059	3.080E-1	603	0.195	0.129	O42967.pdb.gz	YB92_SCHPO Uncharacterized ubiquitin-like protein C1E8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1E8.02 PE=1 SV=1
12	PDB:7ploI	0.115	0.102	4.334E-1	451	0.030	0.027	7ploI.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
13	PDB:7pj1B	0.071	0.161	5.648	122	0.048	0.156	7pj1B.pdb.gz
14	PDB:7qsmW	0.082	0.211	5.648	116	0.030	0.103	7qsmW.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
15	PDB:1qsdA	0.068	0.176	6.013	102	0.030	0.118	1qsdA.pdb.gz
16	PDB:7zs9M	0.093	0.114	6.013	310	0.018	0.023	7zs9M.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
17	PDB:1vfiA	0.102	0.234	6.815	95	0.028	0.116	1vfiA.pdb.gz
18	PDB:4btpA	0.073	0.043	6.815	749	0.023	0.012	4btpA.pdb.gz
19	PDB:1f6fA	0.074	0.145	7.724	183	0.030	0.066	1f6fA.pdb.gz
20	PDB:3c3wA	0.075	0.117	8.755	211	0.025	0.047	3c3wA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O93345	0.0	661	369	0.850	0.919	O93345_CHICK Lymphiod enhancer binding factor 1 OS=Gallus gallus OX=9031 GN=Lef-1 PE=2 SV=1
2	P27782	0.0	794	397	0.972	0.977	LEF1_MOUSE Lymphoid enhancer-binding factor 1 OS=Mus musculus OX=10090 GN=Lef1 PE=1 SV=1
3	Q9QXN1	0.0	786	397	0.962	0.967	LEF1_RAT Lymphoid enhancer-binding factor 1 OS=Rattus norvegicus OX=10116 GN=Lef1 PE=2 SV=1
4	Q9UJU2	0.0	820	399	1.000	1.000	LEF1_HUMAN Lymphoid enhancer-binding factor 1 OS=Homo sapiens OX=9606 GN=LEF1 PE=1 SV=1
5	Q9W7C0	0.0	577	365	0.784	0.858	Q9W7C0_DANRE Lymphocyte enhancer binding factor 1 OS=Danio rerio OX=7955 GN=lef1 PE=2 SV=1
6	Q71G54	4.87e-128	379	477	0.581	0.486	Q71G54_DANRE Transcription factor 7-like 2 OS=Danio rerio OX=7955 GN=tcf4 PE=2 SV=1
7	D3YWT3	1.35e-127	376	442	0.579	0.523	D3YWT3_MOUSE Transcription factor 7 like 2, T cell specific, HMG box OS=Mus musculus OX=10090 GN=Tcf7l2 PE=1 SV=1
8	Q924A0	6.27e-127	375	459	0.579	0.503	TF7L2_MOUSE Transcription factor 7-like 2 OS=Mus musculus OX=10090 GN=Tcf7l2 PE=1 SV=2
9	A0A8I6ARM6	4.66e-126	377	581	0.579	0.398	A0A8I6ARM6_RAT Transcription factor 7 like 2 OS=Rattus norvegicus OX=10116 GN=Tcf7l2 PE=1 SV=1
10	D3Z9D1	1.15e-125	377	598	0.579	0.386	D3Z9D1_RAT Transcription factor 7 like 2 OS=Rattus norvegicus OX=10116 GN=Tcf7l2 PE=1 SV=4
11	A0A8I6A761	5.27e-118	353	465	0.566	0.486	A0A8I6A761_RAT Transcription factor 7 like 2 OS=Rattus norvegicus OX=10116 GN=Tcf7l2 PE=1 SV=1
12	P70062	1.14e-116	352	554	0.559	0.403	T7L1A_XENLA Transcription factor 7-like 1-A OS=Xenopus laevis OX=8355 GN=tcf7l1-a PE=1 SV=1
13	A0A8I6AGH1	8.15e-115	349	604	0.566	0.374	A0A8I6AGH1_RAT Transcription factor 7 like 2 OS=Rattus norvegicus OX=10116 GN=Tcf7l2 PE=1 SV=1
14	Q90ZB6	1.50e-112	342	551	0.549	0.397	T7L1B_XENLA Transcription factor 7-like 1-B OS=Xenopus laevis OX=8355 GN=tcf7l1-b PE=1 SV=1
15	Q9NQB0	1.95e-112	343	619	0.561	0.362	TF7L2_HUMAN Transcription factor 7-like 2 OS=Homo sapiens OX=9606 GN=TCF7L2 PE=1 SV=2
16	Q9YHE8	3.06e-112	341	560	0.551	0.393	T7L1A_DANRE Transcription factor 7-like 1-A OS=Danio rerio OX=7955 GN=tcf7l1a PE=1 SV=1
17	Q800Q5	1.67e-109	334	551	0.561	0.407	T7L1B_DANRE Transcription factor 7-like 1-B OS=Danio rerio OX=7955 GN=tcf7l1b PE=2 SV=1
18	Q9HCS4	3.15e-109	334	588	0.524	0.355	TF7L1_HUMAN Transcription factor 7-like 1 OS=Homo sapiens OX=9606 GN=TCF7L1 PE=1 SV=1
19	D4A8X6	2.04e-107	320	299	0.441	0.589	D4A8X6_RAT Transcription factor 7 like 2 OS=Rattus norvegicus OX=10116 GN=Tcf7l2 PE=3 SV=4
20	Q9Z1J1	2.65e-107	329	584	0.511	0.349	TF7L1_MOUSE Transcription factor 7-like 1 OS=Mus musculus OX=10090 GN=Tcf7l1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08347 CTNNB1_binding	4.4e-85	296.6	N-terminal CTNNB1 binding
2	PF00505 HMG_box	2.7e-18	77.5	HMG (high mobility group) box
3	PF09011 HMG_box_2	4.4e-05	35.3	HMG-box domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265165

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344456	0.999	Catenin beta-1
2	9606.ENSP00000341551	0.997	Mothers against decapentaplegic homolog 4
3	9606.ENSP00000362649	0.996	Histone deacetylase 1
4	9606.ENSP00000384625	0.995	Serine/threonine-protein kinase NLK
5	9606.ENSP00000365682	0.994	Transducin-like enhancer protein 1
6	9606.ENSP00000304169	0.988	Pituitary homeobox 2
7	9606.ENSP00000302625	0.987	Axin-2
8	9606.ENSP00000312987	0.987	Hepatocyte nuclear factor 4-alpha
9	9606.ENSP00000227507	0.972	G1/S-specific cyclin-D1
10	9606.ENSP00000479618	0.972	Myc proto-oncogene protein
11	9606.ENSP00000466542	0.965	Transducin-like enhancer protein 2
12	9606.ENSP00000231656	0.963	Homeobox protein CDX-1
13	9606.ENSP00000339992	0.956	Transcriptional activator Myb
14	9606.ENSP00000350844	0.956	Paired box protein Pax-5
15	9606.ENSP00000221561	0.954	Amino-terminal enhancer of split
16	9606.ENSP00000263253	0.947	Histone acetyltransferase p300
17	9606.ENSP00000332973	0.947	Mothers against decapentaplegic homolog 3
18	9606.ENSP00000379975	0.936	Integrin-linked protein kinase
19	9606.ENSP00000482674	0.928	Histone H2B type 1-B
20	9606.ENSP00000262320	0.927	Axin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000981	0.999	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0043565	0.999	sequence-specific DNA binding
GO:0005515	0.998	protein binding
GO:0003690	0.995	double-stranded DNA binding
GO:1990837	0.994	sequence-specific double-stranded DNA binding
GO:0000976	0.981	transcription cis-regulatory region binding
GO:0000987	0.918	cis-regulatory region sequence-specific DNA binding
GO:0008134	0.902	transcription factor binding
GO:0000978	0.901	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0019899	0.890	enzyme binding
GO:0001228	0.880	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0140297	0.840	DNA-binding transcription factor binding
GO:0061629	0.606	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0008013	0.585	beta-catenin binding
GO:0001221	0.580	transcription coregulator binding
GO:0001222	0.540	transcription corepressor binding
GO:0045295	0.533	gamma-catenin binding
GO:0070016	0.530	armadillo repeat domain binding
GO:0140416	0.522	transcription regulator inhibitor activity
GO:0070742	0.521	C2H2 zinc finger domain binding
GO:0030331	0.520	nuclear estrogen receptor binding
GO:0042826	0.495	histone deacetylase binding
GO:0042393	0.458	histone binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0050896	0.992	response to stimulus
GO:0032501	0.989	multicellular organismal process
GO:0048856	0.985	anatomical structure development
GO:0019222	0.985	regulation of metabolic process
GO:0060255	0.977	regulation of macromolecule metabolic process
GO:0006355	0.971	regulation of DNA-templated transcription
GO:0007275	0.961	multicellular organism development
GO:0048519	0.955	negative regulation of biological process
GO:0048518	0.954	positive regulation of biological process
GO:0060173	0.952	limb development
GO:0048731	0.942	system development
GO:0048513	0.940	animal organ development
GO:0006357	0.922	regulation of transcription by RNA polymerase II
GO:0048523	0.912	negative regulation of cellular process
GO:0051716	0.911	cellular response to stimulus
GO:0007165	0.876	signal transduction
GO:0007399	0.875	nervous system development
GO:0048522	0.868	positive regulation of cellular process
GO:0051173	0.860	positive regulation of nitrogen compound metabolic process
GO:0010604	0.860	positive regulation of macromolecule metabolic process
GO:0007166	0.856	cell surface receptor signaling pathway
GO:0060070	0.846	canonical Wnt signaling pathway
GO:0031325	0.840	positive regulation of cellular metabolic process
GO:0050793	0.822	regulation of developmental process
GO:0007417	0.789	central nervous system development
GO:0045935	0.775	positive regulation of nucleobase-containing compound metabolic process
GO:0009653	0.731	anatomical structure morphogenesis
GO:0007389	0.726	pattern specification process
GO:0045893	0.715	positive regulation of DNA-templated transcription
GO:0010605	0.693	negative regulation of macromolecule metabolic process
GO:0003002	0.681	regionalization
GO:0051239	0.680	regulation of multicellular organismal process
GO:0030154	0.673	cell differentiation
GO:0045595	0.672	regulation of cell differentiation
GO:0045944	0.669	positive regulation of transcription by RNA polymerase II
GO:0051172	0.668	negative regulation of nitrogen compound metabolic process
GO:0031324	0.662	negative regulation of cellular metabolic process
GO:0009888	0.659	tissue development
GO:0045934	0.653	negative regulation of nucleobase-containing compound metabolic process
GO:0031327	0.648	negative regulation of cellular biosynthetic process
GO:0010558	0.639	negative regulation of macromolecule biosynthetic process
GO:0051253	0.638	negative regulation of RNA metabolic process
GO:0042221	0.631	response to chemical
GO:2000026	0.603	regulation of multicellular organismal development
GO:0042127	0.596	regulation of cell population proliferation
GO:0045892	0.538	negative regulation of DNA-templated transcription
GO:0000122	0.469	negative regulation of transcription by RNA polymerase II
GO:0051094	0.430	positive regulation of developmental process
GO:0048583	0.402	regulation of response to stimulus
GO:0060322	0.391	head development
GO:0010941	0.391	regulation of cell death
GO:0007420	0.382	brain development
GO:0008152	0.380	metabolic process
GO:0023051	0.376	regulation of signaling
GO:0010646	0.376	regulation of cell communication
GO:0045597	0.372	positive regulation of cell differentiation
GO:0009966	0.371	regulation of signal transduction
GO:0071704	0.330	organic substance metabolic process
GO:0044238	0.326	primary metabolic process
GO:0044237	0.316	cellular metabolic process
GO:0065009	0.315	regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.988	cytoplasm
GO:0032991	0.972	protein-containing complex
GO:0005667	0.510	transcription regulator complex
GO:0140513	0.462	nuclear protein-containing complex
GO:0090575	0.423	RNA polymerase II transcription regulator complex
GO:0032993	0.317	protein-DNA complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]