StarFunc result for job id Q9UJV3

User Input

>input (735 residues)
MGESPASVVLNASGGLFSLKMETLESELTCPICLELFEDPLLLPCAHSLCFSCAHRILVS
SCSSGESIEPITAFQCPTCRYVISLNHRGLDGLKRNVTLQNIIDRFQKASVSGPNSPSES
RRERTYRPTTAMSSERIACQFCEQDPPRDAVKTCITCEVSYCDRCLRATHPNKKPFTSHR
LVEPVPDTHLRGITCLDHENEKVNMYCVSDDQLICALCKLVGRHRDHQVASLNDRFEKLK
QTLEMNLTNLVKRNSELENQMAKLIQICQQVEVNTAMHEAKLMEECDELVEIIQQRKQMI
AVKIKETKVMKLRKLAQQVANCRQCLERSTVLINQAEHILKENDQARFLQSAKNIAERVA
MATASSQVLIPDINFNDAFENFALDFSREKKLLEGLDYLTAPNPPSIREELCTASHDTIT
VHWISDDEFSISSYELQYTIFTGQANFISKSWCSWGLWPEIRKCKEAVSCSRLAGAPRGL
YNSVDSWMIVPNIKQNHYTVHGLQSGTRYIFIVKAINQAGSRNSEPTRLKTNSQPFKLDP
KMTHKKLKISNDGLQMEKDESSLKKSHTPERFSGTGCYGAAGNIFIDSGCHYWEVVMGSS
TWYAIGIAYKSAPKNEWIGKNASSWVFSRCNSNFVVRHNNKEMLVDVPPHLKRLGVLLDY
DNNMLSFYDPANSLHLHTFDVTFILPVCPTFTIWNKSLMILSGLPAPDFIDYPERQECNC
RPQESPYVSGMKTCH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UJV3	1.000	1.000	0.000	735	1.000	1.000	Q9UJV3.pdb.gz	TRIM1_HUMAN Probable E3 ubiquitin-protein ligase MID2 OS=Homo sapiens OX=9606 GN=MID2 PE=1 SV=3
2	AFDB:O70583	0.859	0.926	2.609E-101	680	0.678	0.732	O70583.pdb.gz	TRI18_MOUSE E3 ubiquitin-protein ligase Midline-1 OS=Mus musculus OX=10090 GN=Mid1 PE=1 SV=2
3	AFDB:Q505D9	0.368	0.355	8.398E-46	768	0.249	0.238	Q505D9.pdb.gz	TRI67_MOUSE Tripartite motif-containing protein 67 OS=Mus musculus OX=10090 GN=Trim67 PE=2 SV=1
4	AFDB:Q91ZY8	0.321	0.330	1.043E-45	710	0.244	0.252	Q91ZY8.pdb.gz	TRIM9_RAT E3 ubiquitin-protein ligase TRIM9 OS=Rattus norvegicus OX=10116 GN=Trim9 PE=1 SV=1
5	AFDB:Q80WG7	0.262	0.263	1.568E-44	729	0.238	0.240	Q80WG7.pdb.gz	TRI36_MOUSE E3 ubiquitin-protein ligase Trim36 OS=Mus musculus OX=10090 GN=Trim36 PE=1 SV=2
6	AFDB:A0A0G2JXN2	0.336	0.328	8.885E-44	759	0.227	0.220	A0A0G2JXN2.pdb.gz	TRI46_RAT Tripartite motif-containing protein 46 OS=Rattus norvegicus OX=10116 GN=Trim46 PE=1 SV=2
7	AFDB:Q8C7M3	0.336	0.308	5.178E-42	817	0.248	0.223	Q8C7M3.pdb.gz	TRIM9_MOUSE E3 ubiquitin-protein ligase TRIM9 OS=Mus musculus OX=10090 GN=Trim9 PE=1 SV=2
8	AFDB:M9MRI4	0.315	0.313	1.492E-40	740	0.237	0.235	M9MRI4.pdb.gz	TRIM9_DROME E3 ubiquitin-protein ligase TRIM9 OS=Drosophila melanogaster OX=7227 GN=Trim9 PE=1 SV=1
9	AFDB:Q9UAQ3	0.357	0.345	2.124E-39	765	0.224	0.216	Q9UAQ3.pdb.gz	Q9UAQ3_CAEEL E3 ubiquitin-protein ligase TRIM9 OS=Caenorhabditis elegans OX=6239 GN=madd-2 PE=4 SV=2
10	AFDB:A1L4K1	0.239	0.234	3.199E-36	749	0.223	0.219	A1L4K1.pdb.gz	FSD2_HUMAN Fibronectin type III and SPRY domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FSD2 PE=1 SV=1
11	PDB:7y4sA	0.223	0.463	6.881E-12	343	0.098	0.210	7y4sA.pdb.gz
12	PDB:4b3nA	0.190	0.248	1.395E-9	557	0.045	0.059	4b3nA.pdb.gz	Structural Insight Into HIV-1 Capsid Recognition by Rhesus Trim5Alpha
13	PDB:7z36B	0.273	0.405	1.324E-7	446	0.084	0.139	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
14	PDB:7ccbA	0.176	0.722	1.736E-7	164	0.044	0.195	7ccbA.pdb.gz
15	PDB:7nscA	0.200	0.504	2.679E-7	276	0.038	0.101	7nscA.pdb.gz
16	PDB:6pxvA	0.137	0.125	3.423E-6	823	0.052	0.046	6pxvA.pdb.gz
17	PDB:6swy1	0.165	0.218	3.520E-5	542	0.037	0.050	6swy1.pdb.gz
18	PDB:7u7nC	0.103	0.336	8.379E-5	200	0.052	0.190	7u7nC.pdb.gz
19	PDB:6wotA	0.138	0.025	1.293E-4	4197	0.026	0.005	6wotA.pdb.gz	Structural mechanism of two gain-of-function cardiac and skeletal RyR mutations at an equivalent site by cryo-EM.
20	PDB:6pyhD	0.144	0.134	1.521E-4	798	0.054	0.050	6pyhD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C9J453	0.0	818	483	0.525	0.799	C9J453_HUMAN RING-type E3 ubiquitin transferase (Fragment) OS=Homo sapiens OX=9606 GN=MID1 PE=1 SV=1
2	O15344	0.0	1091	667	0.690	0.760	TRI18_HUMAN E3 ubiquitin-protein ligase Midline-1 OS=Homo sapiens OX=9606 GN=MID1 PE=1 SV=1
3	O70583	0.0	1073	680	0.682	0.737	TRI18_MOUSE E3 ubiquitin-protein ligase Midline-1 OS=Mus musculus OX=10090 GN=Mid1 PE=1 SV=2
4	Q9UJV3	0.0	1539	735	1.000	1.000	TRIM1_HUMAN Probable E3 ubiquitin-protein ligase MID2 OS=Homo sapiens OX=9606 GN=MID2 PE=1 SV=3
5	Q80WG7	1.62e-58	213	729	0.260	0.262	TRI36_MOUSE E3 ubiquitin-protein ligase Trim36 OS=Mus musculus OX=10090 GN=Trim36 PE=1 SV=2
6	Q9NQ86	1.15e-57	211	728	0.177	0.179	TRI36_HUMAN E3 ubiquitin-protein ligase TRIM36 OS=Homo sapiens OX=9606 GN=TRIM36 PE=1 SV=2
7	Q9BTV5	2.03e-54	197	496	0.200	0.296	FSD1_HUMAN Fibronectin type III and SPRY domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FSD1 PE=1 SV=1
8	Q7TNM2	1.23e-52	197	759	0.248	0.240	TRI46_MOUSE Tripartite motif-containing protein 46 OS=Mus musculus OX=10090 GN=Trim46 PE=1 SV=1
9	A0A0G2JXN2	1.52e-52	197	759	0.246	0.238	TRI46_RAT Tripartite motif-containing protein 46 OS=Rattus norvegicus OX=10116 GN=Trim46 PE=1 SV=2
10	Q1LY10	2.00e-52	191	495	0.199	0.295	FSD1_DANRE Fibronectin type III and SPRY domain-containing protein 1 OS=Danio rerio OX=7955 GN=fsd1 PE=3 SV=1
11	Q91ZY8	9.05e-49	185	710	0.222	0.230	TRIM9_RAT E3 ubiquitin-protein ligase TRIM9 OS=Rattus norvegicus OX=10116 GN=Trim9 PE=1 SV=1
12	Q9C026	9.23e-49	185	710	0.222	0.230	TRIM9_HUMAN E3 ubiquitin-protein ligase TRIM9 OS=Homo sapiens OX=9606 GN=TRIM9 PE=1 SV=1
13	Q505D9	6.58e-45	174	768	0.215	0.206	TRI67_MOUSE Tripartite motif-containing protein 67 OS=Mus musculus OX=10090 GN=Trim67 PE=2 SV=1
14	A1L4K1	1.92e-44	173	749	0.212	0.208	FSD2_HUMAN Fibronectin type III and SPRY domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FSD2 PE=1 SV=1
15	M9MRI4	6.80e-42	165	740	0.214	0.212	TRIM9_DROME E3 ubiquitin-protein ligase TRIM9 OS=Drosophila melanogaster OX=7227 GN=Trim9 PE=1 SV=1
16	H0UZ81	2.11e-40	160	719	0.203	0.207	FSD2_CAVPO Fibronectin type III and SPRY domain-containing protein 2 OS=Cavia porcellus OX=10141 GN=FSD2 PE=2 SV=2
17	Q8C7M3	1.09e-38	156	817	0.136	0.122	TRIM9_MOUSE E3 ubiquitin-protein ligase TRIM9 OS=Mus musculus OX=10090 GN=Trim9 PE=1 SV=2
18	Q8BZ52	1.91e-38	154	716	0.197	0.203	FSD2_MOUSE Fibronectin type III and SPRY domain-containing protein 2 OS=Mus musculus OX=10090 GN=Fsd2 PE=1 SV=3
19	Q14258	1.78e-30	129	630	0.222	0.259	TRI25_HUMAN E3 ubiquitin/ISG15 ligase TRIM25 OS=Homo sapiens OX=9606 GN=TRIM25 PE=1 SV=2
20	G3X8Y1	4.65e-28	121	545	0.127	0.171	G3X8Y1_MOUSE Tripartite motif-containing 55 OS=Mus musculus OX=10090 GN=Trim55 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18568 COS	7e-28	107.8	TRIM C-terminal subgroup One Signature domain
2	PF00041 fn3	0.023	26.4	Fibronectin type III domain
3	PF13765 PRY	16	16.5	SPRY-associated domain
4	PF16656 Pur_ac_phosph_N	4e+02	13.1	Purple acid Phosphatase, N-terminal domain
5	PF00622 SPRY	1.6e-07	42.8	SPRY domain
6	PF00643 zf-B_box	1.9e-05	36.0	B-box zinc finger
7	PF00097 zf-C3HC4	0.0069	27.6	Zinc finger, C3HC4 type (RING finger)
8	PF13923 zf-C3HC4_2	0.063	24.4	Zinc finger, C3HC4 type (RING finger)
9	PF13920 zf-C3HC4_3	0.0025	28.9	Zinc finger, C3HC4 type (RING finger)
10	PF15227 zf-C3HC4_4	0.014	26.8	zinc finger of C3HC4-type, RING
11	PF13639 zf-RING_2	0.08	24.6	Ring finger domain
12	PF14634 zf-RING_5	0.66	21.3	zinc-RING finger domain
13	PF13445 zf-RING_UBOX	0.0019	29.5	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262843

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000312678	0.884	E3 ubiquitin-protein ligase Midline-1
2	9606.ENSP00000378340	0.748	Collagen alpha-6(IV) chain
3	9606.ENSP00000424595	0.735	Ribose-phosphate pyrophosphokinase 3
4	9606.ENSP00000361512	0.733	Ribose-phosphate pyrophosphokinase 1
5	9606.ENSP00000363661	0.731	Immunoglobulin-binding protein 1
6	9606.ENSP00000381504	0.726	Ribose-phosphate pyrophosphokinase 2
7	9606.ENSP00000222402	0.693	Ubiquitin-conjugating enzyme E2 D4
8	9606.ENSP00000263925	0.680	E3 ubiquitin-protein ligase LNX
9	9606.ENSP00000268058	0.662	Protein PML
10	9606.ENSP00000295756	0.661	T-cell receptor-associated transmembrane adapter 1
11	9606.ENSP00000263182	0.616	Gamma-butyrobetaine dioxygenase
12	9606.ENSP00000369373	0.614	Tripartite motif-containing protein 5
13	9606.ENSP00000339971	0.609	Protein MROH8
14	9606.ENSP00000356379	0.591	Abnormal spindle-like microcephaly-associated protein
15	9606.ENSP00000316176	0.583	Ubiquitin-conjugating enzyme E2 N
16	9606.ENSP00000370639	0.540	Acetylserotonin O-methyltransferase
17	9606.ENSP00000335261	0.538	Trimethyllysine dioxygenase, mitochondrial
18	9606.ENSP00000262648	0.519	Anosmin-1
19	9606.ENSP00000278833	0.501	Rod outer segment membrane protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0042802	0.940	identical protein binding
GO:0003713	0.869	transcription coactivator activity
GO:0003824	0.695	catalytic activity
GO:0016740	0.663	transferase activity
GO:0019899	0.585	enzyme binding
GO:0140096	0.556	catalytic activity, acting on a protein
GO:0046983	0.447	protein dimerization activity
GO:0042803	0.425	protein homodimerization activity
GO:0015631	0.331	tubulin binding
GO:0051219	0.325	phosphoprotein binding
GO:0008017	0.303	microtubule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.981	regulation of cellular process
GO:0009987	0.978	cellular process
GO:0048584	0.965	positive regulation of response to stimulus
GO:0050896	0.945	response to stimulus
GO:0009967	0.939	positive regulation of signal transduction
GO:0019222	0.809	regulation of metabolic process
GO:0048519	0.794	negative regulation of biological process
GO:1902531	0.785	regulation of intracellular signal transduction
GO:0031323	0.759	regulation of cellular metabolic process
GO:0006950	0.745	response to stress
GO:0051179	0.742	localization
GO:0060255	0.740	regulation of macromolecule metabolic process
GO:0050792	0.729	regulation of viral process
GO:1902533	0.725	positive regulation of intracellular signal transduction
GO:0080090	0.722	regulation of primary metabolic process
GO:0072698	0.702	protein localization to microtubule cytoskeleton
GO:0051171	0.697	regulation of nitrogen compound metabolic process
GO:0065009	0.681	regulation of molecular function
GO:0009615	0.674	response to virus
GO:0043122	0.665	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0051091	0.665	positive regulation of DNA-binding transcription factor activity
GO:0006952	0.629	defense response
GO:0051092	0.612	positive regulation of NF-kappaB transcription factor activity
GO:1903900	0.603	regulation of viral life cycle
GO:0048525	0.587	negative regulation of viral process
GO:0043903	0.540	regulation of biological process involved in symbiotic interaction
GO:1903901	0.534	negative regulation of viral life cycle
GO:0052372	0.466	modulation by symbiont of entry into host
GO:0008152	0.463	metabolic process
GO:0046596	0.462	regulation of viral entry into host cell
GO:0140546	0.447	defense response to symbiont
GO:0071704	0.422	organic substance metabolic process
GO:0002376	0.393	immune system process
GO:0044238	0.384	primary metabolic process
GO:0006807	0.369	nitrogen compound metabolic process
GO:1901564	0.333	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.996	membrane-bounded organelle
GO:0015630	0.996	microtubule cytoskeleton
GO:0005737	0.989	cytoplasm
GO:0005829	0.952	cytosol
GO:0043231	0.932	intracellular membrane-bounded organelle
GO:0012505	0.833	endomembrane system
GO:0005576	0.786	extracellular region
GO:0005874	0.664	microtubule
GO:0031982	0.566	vesicle
GO:0043230	0.325	extracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.663	Transferases.

[back to server]