StarFunc result for job id Q9UJX2

User Input

>input (597 residues)
MAASTSMVPVAVTAAVAPVLSINSDFSDLREIKKQLLLIAGLTRERGLLHSSKWSAELAF
SLPALPLAELQPPPPITEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMY
SRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSKKHQARELDGFGLYLYGVVLR
KLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTE
LQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENM
DTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKL
NPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLY
YYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQL
TESEQAAQCYIKYIQDIYSCGEIVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFN
DTREEGKALLRQILQLRNQGETPTTEVPAPFFLPASLSANNTPTRRVSPLNLSSVTP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UJX2	1.000	1.000	2.842E-72	597	1.000	1.000	Q9UJX2.pdb.gz	CDC23_HUMAN Cell division cycle protein 23 homolog OS=Homo sapiens OX=9606 GN=CDC23 PE=1 SV=3
2	AFDB:Q7T0N9	0.901	0.928	2.145E-60	580	0.861	0.886	Q7T0N9.pdb.gz	Q7T0N9_XENLA Cell division cycle 23 L homeolog OS=Xenopus laevis OX=8355 GN=cdc23.L PE=1 SV=1
3	PDB:7qe7U	0.841	0.925	6.862E-58	540	0.903	0.998	7qe7U.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
4	AFDB:Q9I7L8	0.838	0.741	6.233E-37	678	0.452	0.398	Q9I7L8.pdb.gz	Q9I7L8_DROME Cell division cycle 23, isoform A OS=Drosophila melanogaster OX=7227 GN=Cdc23 PE=2 SV=2
5	AFDB:Q9STS3	0.837	0.863	2.766E-34	579	0.394	0.406	Q9STS3.pdb.gz	CDC23_ARATH Anaphase-promoting complex subunit 8 OS=Arabidopsis thaliana OX=3702 GN=APC8 PE=1 SV=1
6	AFDB:O94556	0.808	0.851	4.187E-31	565	0.369	0.389	O94556.pdb.gz	APC8_SCHPO Anaphase-promoting complex subunit 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cut23 PE=1 SV=2
7	AFDB:Q19294	0.808	0.720	1.575E-27	673	0.320	0.284	Q19294.pdb.gz	CDC23_CAEEL Cell division cycle protein 23 homolog OS=Caenorhabditis elegans OX=6239 GN=mat-3 PE=1 SV=2
8	AFDB:P16522	0.790	0.755	1.832E-26	626	0.300	0.286	P16522.pdb.gz	CDC23_YEAST Anaphase-promoting complex subunit CDC23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC23 PE=1 SV=1
9	PDB:8a3tD	0.794	0.844	3.671E-25	560	0.291	0.311	8a3tD.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
10	AFDB:Q4GYI6	0.618	0.420	3.444E-20	907	0.268	0.176	Q4GYI6.pdb.gz	Q4GYI6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.3910 PE=4 SV=1
11	AFDB:Q8VY89	0.521	0.553	4.388E-15	558	0.178	0.190	Q8VY89.pdb.gz	APC7_ARATH Anaphase-promoting complex subunit 7 OS=Arabidopsis thaliana OX=3702 GN=APC7 PE=2 SV=1
12	AFDB:P10505	0.562	0.512	5.789E-15	665	0.193	0.173	P10505.pdb.gz	APC3_SCHPO Anaphase-promoting complex subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nuc2 PE=1 SV=3
13	PDB:7qe7J	0.583	0.671	8.511E-15	510	0.181	0.212	7qe7J.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
14	PDB:8a3tH	0.636	0.741	7.214E-14	505	0.176	0.208	8a3tH.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
15	PDB:8a3tJ	0.596	0.683	3.929E-12	509	0.174	0.204	8a3tJ.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
16	PDB:5g05F	0.510	0.644	4.789E-12	460	0.176	0.228	5g05F.pdb.gz	Molecular Mechanism of Apc/C Activation by Mitotic Phosphorylation.
17	PDB:7qe7Y	0.531	0.618	8.011E-12	502	0.139	0.165	7qe7Y.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
18	PDB:7qe7K	0.481	0.533	5.572E-11	531	0.149	0.168	7qe7K.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
19	PDB:7ntfA	0.405	0.283	2.140E-10	918	0.109	0.071	7ntfA.pdb.gz
20	PDB:6xt9D	0.318	0.450	3.135E-8	396	0.106	0.159	6xt9D.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7T0N9	0.0	1077	580	0.861	0.886	Q7T0N9_XENLA Cell division cycle 23 L homeolog OS=Xenopus laevis OX=8355 GN=cdc23.L PE=1 SV=1
2	Q9UJX2	0.0	1241	597	1.000	1.000	CDC23_HUMAN Cell division cycle protein 23 homolog OS=Homo sapiens OX=9606 GN=CDC23 PE=1 SV=3
3	Q9I7L8	7.65e-173	508	678	0.444	0.391	Q9I7L8_DROME Cell division cycle 23, isoform A OS=Drosophila melanogaster OX=7227 GN=Cdc23 PE=2 SV=2
4	Q9STS3	2.49e-142	426	579	0.392	0.404	CDC23_ARATH Anaphase-promoting complex subunit 8 OS=Arabidopsis thaliana OX=3702 GN=APC8 PE=1 SV=1
5	O94556	6.19e-119	366	565	0.372	0.393	APC8_SCHPO Anaphase-promoting complex subunit 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cut23 PE=1 SV=2
6	Q19294	3.20e-93	302	673	0.305	0.270	CDC23_CAEEL Cell division cycle protein 23 homolog OS=Caenorhabditis elegans OX=6239 GN=mat-3 PE=1 SV=2
7	P16522	1.11e-72	246	626	0.271	0.259	CDC23_YEAST Anaphase-promoting complex subunit CDC23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC23 PE=1 SV=1
8	Q4GYI6	1.21e-50	190	907	0.211	0.139	Q4GYI6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.3910 PE=4 SV=1
9	P10505	5.48e-32	133	665	0.121	0.108	APC3_SCHPO Anaphase-promoting complex subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nuc2 PE=1 SV=3
10	Q06AN9	1.79e-29	126	717	0.119	0.099	CD27A_ARATH Cell division cycle protein 27 homolog A OS=Arabidopsis thaliana OX=3702 GN=CDC27A PE=1 SV=2
11	Q8LGU6	9.93e-29	124	744	0.121	0.097	CD27B_ARATH Cell division cycle protein 27 homolog B OS=Arabidopsis thaliana OX=3702 GN=CDC27B PE=1 SV=1
12	P30260	1.74e-28	123	824	0.102	0.074	CDC27_HUMAN Cell division cycle protein 27 homolog OS=Homo sapiens OX=9606 GN=CDC27 PE=1 SV=2
13	G5EA36	1.77e-28	123	823	0.102	0.074	G5EA36_HUMAN Cell division cycle 27 OS=Homo sapiens OX=9606 GN=CDC27 PE=1 SV=1
14	Q0P4V8	4.79e-28	122	832	0.101	0.072	Q0P4V8_XENTR Cell division cycle protein 27 homolog OS=Xenopus tropicalis OX=8364 GN=cdc27 PE=1 SV=1
15	Q6GQ04	1.02e-27	120	833	0.099	0.071	Q6GQ04_XENLA MGC80529 protein OS=Xenopus laevis OX=8355 GN=MGC80529 PE=1 SV=1
16	Q9VS37	5.64e-26	115	900	0.104	0.069	Q9VS37_DROME Cell division cycle 27, isoform A OS=Drosophila melanogaster OX=7227 GN=Cdc27 PE=1 SV=1
17	Q24021	1.18e-25	114	875	0.104	0.071	Q24021_DROME CDC27Dm OS=Drosophila melanogaster OX=7227 GN=Cdc27 PE=2 SV=1
18	P38042	2.22e-22	104	758	0.114	0.090	CDC27_YEAST Anaphase-promoting complex subunit CDC27 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC27 PE=1 SV=2
19	Q9N593	6.57e-19	93.2	788	0.112	0.085	CDC27_CAEEL Cell division cycle protein 27 homolog OS=Caenorhabditis elegans OX=6239 GN=mat-1 PE=1 SV=1
20	Q389U4	7.19e-13	73.6	557	0.085	0.092	Q389U4_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.406.0610 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12895 ANAPC3	0.0043	28.6	Anaphase-promoting complex, cyclosome, subunit 3
2	PF04049 ANAPC8	4.8e-22	90.0	Anaphase promoting complex subunit 8 / Cdc23
3	PF05598 DUF772	10	17.5	Transposase domain (DUF772)
4	PF20308 TPR-S	5.7e+02	12.5	Tetratricopeptide Repeats-Sensor
5	PF00515 TPR_1	2e-22	89.2	Tetratricopeptide repeat
6	PF13374 TPR_10	16	16.7	Tetratricopeptide repeat
7	PF13414 TPR_11	4.3e-07	40.8	TPR repeat
8	PF13424 TPR_12	0.32	22.6	Tetratricopeptide repeat
9	PF13428 TPR_14	3e-11	54.1	Tetratricopeptide repeat
10	PF13429 TPR_15	3.2e+02	12.0	Tetratricopeptide repeat
11	PF13432 TPR_16	8e-05	34.4	Tetratricopeptide repeat
12	PF13431 TPR_17	0.00034	31.8	Tetratricopeptide repeat
13	PF14559 TPR_19	4.2e-10	51.2	Tetratricopeptide repeat
14	PF07719 TPR_2	1.2e-21	86.0	Tetratricopeptide repeat
15	PF13174 TPR_6	0.00083	31.0	Tetratricopeptide repeat
16	PF13176 TPR_7	1.6e-05	35.6	Tetratricopeptide repeat
17	PF13181 TPR_8	1.5e-14	63.9	Tetratricopeptide repeat
18	PF13371 TPR_9	15	17.1	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378350

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261819	0.999	Anaphase-promoting complex subunit 5
2	9606.ENSP00000314004	0.999	Anaphase-promoting complex subunit 2
3	9606.ENSP00000339109	0.999	Anaphase-promoting complex subunit 1
4	9606.ENSP00000349957	0.999	Anaphase promoting complex subunit 11
5	9606.ENSP00000353549	0.999	Cell division cycle protein 16 homolog
6	9606.ENSP00000361540	0.999	Cell division cycle protein 20 homolog
7	9606.ENSP00000363322	0.999	Anaphase-promoting complex subunit CDC26
8	9606.ENSP00000378529	0.999	Fizzy-related protein homolog
9	9606.ENSP00000394394	0.999	Anaphase-promoting complex subunit 7
10	9606.ENSP00000421842	0.999	Anaphase-promoting complex subunit 13
11	9606.ENSP00000426654	0.999	Anaphase-promoting complex subunit 4
12	9606.ENSP00000434614	0.999	Cell division cycle protein 27 homolog
13	9606.ENSP00000477760	0.999	Anaphase-promoting complex subunit 16
14	9606.ENSP00000478501	0.999	Anaphase-promoting complex subunit 10
15	9606.ENSP00000287598	0.998	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
16	9606.ENSP00000439403	0.998	Anaphase-promoting complex subunit 15
17	9606.ENSP00000296509	0.996	Mitotic spindle assembly checkpoint protein MAD2A
18	9606.ENSP00000348838	0.994	Ubiquitin-conjugating enzyme E2 C
19	9606.ENSP00000357858	0.992	Mitotic checkpoint protein BUB3
20	9606.ENSP00000229758	0.986	F-box only protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.984	catalytic activity
GO:0140096	0.939	catalytic activity, acting on a protein
GO:0016740	0.923	transferase activity
GO:0019787	0.503	ubiquitin-like protein transferase activity
GO:0004842	0.480	ubiquitin-protein transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0016567	0.985	protein ubiquitination
GO:0010564	0.965	regulation of cell cycle process
GO:0044237	0.917	cellular metabolic process
GO:0000209	0.913	protein polyubiquitination
GO:0000278	0.906	mitotic cell cycle
GO:1903047	0.896	mitotic cell cycle process
GO:0033044	0.852	regulation of chromosome organization
GO:0051983	0.781	regulation of chromosome segregation
GO:0033045	0.724	regulation of sister chromatid segregation
GO:0071840	0.689	cellular component organization or biogenesis
GO:0044260	0.688	cellular macromolecule metabolic process
GO:0016043	0.660	cellular component organization
GO:0007346	0.626	regulation of mitotic cell cycle
GO:1901987	0.608	regulation of cell cycle phase transition
GO:1901990	0.587	regulation of mitotic cell cycle phase transition
GO:0006996	0.440	organelle organization
GO:0044772	0.413	mitotic cell cycle phase transition
GO:0030071	0.375	regulation of mitotic metaphase/anaphase transition
GO:0007059	0.348	chromosome segregation
GO:0051276	0.346	chromosome organization
GO:0000280	0.345	nuclear division
GO:0048518	0.333	positive regulation of biological process
GO:0044265	0.326	cellular macromolecule catabolic process
GO:0006508	0.316	proteolysis
GO:0043632	0.306	modification-dependent macromolecule catabolic process
GO:0030163	0.306	protein catabolic process
GO:0048522	0.301	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.999	cytosol
GO:0000152	0.999	nuclear ubiquitin ligase complex
GO:0005680	0.993	anaphase-promoting complex
GO:0043232	0.598	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.923	Transferases.

[back to server]