StarFunc result for job id Q9UJX6

User Input

>input (822 residues)
MAAAVVVAEGDSDSRPGQELLVAWNTVSTGLVPPAALGLVSSRTSGAVPPKEEELRAAVE
VLRGHGLHSVLEEWFVEVLQNDLQANISPEFWNAISQCENSADEPQCLLLLLDAFGLLES
RLDPYLRSLELLEKWTRLGLLMGTGAQGLREEVHTMLRGVLFFSTPRTFQEMIQRLYGCF
LRVYMQSKRKGEGGTDPELEGELDSRYARRRYYRLLQSPLCAGCSSDKQQCWCRQALEQF
HQLSQVLHRLSLLERVSAEAVTTTLHQVTRERMEDRCRGEYERSFLREFHKWIERVVGWL
GKVFLQDGPARPASPEAGNTLRRWRCHVQRFFYRIYASLRIEELFSIVRDFPDSRPAIED
LKYCLERTDQRQQLLVSLKAALETRLLHPGVNTCDIITLYISAIKALRVLDPSMVILEVA
CEPIRRYLRTREDTVRQIVAGLTGDSDGTGDLAVELSKTDPASLETGQDSEDDSGEPEDW
VPDPVDADPGKSSSKRRSSDIISLLVSIYGSKDLFINEYRSLLADRLLHQFSFSPEREIR
NVELLKLRFGEAPMHFCEVMLKDMADSRRINANIREEDEKRPAEEQPPFGVYAVILSSEF
WPPFKDEKLEVPEDIRAALEAYCKKYEQLKAMRTLSWKHTLGLVTMDVELADRTLSVAVT
PVQAVILLYFQDQASWTLEELSKAVKMPVALLRRRMSVWLQQGVLREEPPGTFSVIEEER
PQDRDNMVLIDSDDESDSGMASQADQKEEELLLFWTYIQAMLTNLESLSLDRIYNMLRMF
VVTGPALAEIDLQELQGYLQKKVRDQQLVYSAGVYRLPKNCS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BZQ7	0.893	0.878	2.800E-94	837	0.944	0.927	Q8BZQ7.pdb.gz	ANC2_MOUSE Anaphase-promoting complex subunit 2 OS=Mus musculus OX=10090 GN=Anapc2 PE=1 SV=2
2	PDB:7qe7N	0.705	0.834	8.921E-71	682	0.825	0.994	7qe7N.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
3	PDB:6q6gN	0.673	0.824	9.874E-61	656	0.793	0.994	6q6gN.pdb.gz	Cyclin A2 degradation during the spindle assembly checkpoint requires multiple binding modes to the APC/C.
4	PDB:6tm5N	0.478	0.574	1.692E-58	676	0.820	0.997	6tm5N.pdb.gz	A unique binding mode of Nek2A to the APC/C allows its ubiquitination during prometaphase.
5	PDB:5lcwN	0.614	0.705	4.473E-58	703	0.849	0.993	5lcwN.pdb.gz	Molecular basis of APC/C regulation by the spindle assembly checkpoint.
6	PDB:5khrN	0.625	0.771	1.262E-53	645	0.779	0.992	5khrN.pdb.gz
7	AFDB:Q9W1E5	0.813	0.832	5.821E-47	802	0.350	0.359	Q9W1E5.pdb.gz	Q9W1E5_DROME Anaphase-promoting complex subunit 2 OS=Drosophila melanogaster OX=7227 GN=mr PE=1 SV=1
8	AFDB:Q8H1U5	0.776	0.740	1.022E-40	865	0.313	0.297	Q8H1U5.pdb.gz	APC2_ARATH Anaphase-promoting complex subunit 2 OS=Arabidopsis thaliana OX=3702 GN=APC2 PE=1 SV=1
9	AFDB:Q551S9	0.772	0.705	1.176E-37	907	0.282	0.256	Q551S9.pdb.gz	APC2_DICDI Anaphase-promoting complex subunit 2 OS=Dictyostelium discoideum OX=44689 GN=anapc2 PE=3 SV=1
10	AFDB:Q874R3	0.653	0.771	2.725E-32	681	0.241	0.291	Q874R3.pdb.gz	APC2_SCHPO Anaphase-promoting complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=apc2 PE=1 SV=1
11	AFDB:P34514	0.603	0.667	3.776E-25	731	0.209	0.235	P34514.pdb.gz	ANC2_CAEEL Anaphase-promoting complex subunit 2 OS=Caenorhabditis elegans OX=6239 GN=apc-2 PE=1 SV=3
12	AFDB:Q38DN8	0.649	0.686	5.437E-25	770	0.214	0.229	Q38DN8.pdb.gz	Q38DN8_TRYB2 Anaphase-promoting complex subunit 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.2660 PE=3 SV=1
13	AFDB:Q12440	0.500	0.485	4.004E-22	853	0.213	0.205	Q12440.pdb.gz	APC2_YEAST Anaphase-promoting complex subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=APC2 PE=1 SV=1
14	PDB:8a5yT	0.473	0.580	7.323E-17	650	0.168	0.212	8a5yT.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex and comparison to apo unphosphorylated and phosphorylated states
15	AFDB:Q17392	0.360	0.354	6.228E-16	840	0.151	0.148	Q17392.pdb.gz	CUL4_CAEEL Cullin-4 OS=Caenorhabditis elegans OX=6239 GN=cul-4 PE=1 SV=3
16	AFDB:Q5ZC88	0.366	0.399	7.368E-15	744	0.144	0.159	Q5ZC88.pdb.gz	CUL1_ORYSJ Cullin-1 OS=Oryza sativa subsp. japonica OX=39947 GN=CUL1 PE=1 SV=1
17	PDB:1ldjA	0.397	0.440	1.278E-11	725	0.130	0.148	1ldjA.pdb.gz	Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.
18	PDB:6v9iC	0.360	0.399	1.503E-11	730	0.142	0.160	6v9iC.pdb.gz	Structure and dynamics of the ASB9 CUL-RING E3 Ligase.
19	PDB:6ttuC	0.339	0.390	2.347E-11	701	0.131	0.154	6ttuC.pdb.gz	NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.
20	PDB:4a0kA	0.414	0.464	7.005E-11	719	0.144	0.164	4a0kA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2RYJ1	0.0	1553	836	0.944	0.928	B2RYJ1_RAT Anaphase-promoting complex subunit 2 OS=Rattus norvegicus OX=10116 GN=Anapc2 PE=1 SV=1
2	F7EWF8	0.0	1479	897	0.926	0.848	F7EWF8_RAT Anaphase-promoting complex subunit 2 OS=Rattus norvegicus OX=10116 GN=Anapc2 PE=1 SV=1
3	Q3B7T7	0.0	1073	539	0.634	0.967	Q3B7T7_RAT Anaphase-promoting complex subunit 2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Anapc2 PE=2 SV=1
4	Q8BZQ7	0.0	1545	837	0.940	0.924	ANC2_MOUSE Anaphase-promoting complex subunit 2 OS=Mus musculus OX=10090 GN=Anapc2 PE=1 SV=2
5	Q9UJX6	0.0	1679	822	1.000	1.000	ANC2_HUMAN Anaphase-promoting complex subunit 2 OS=Homo sapiens OX=9606 GN=ANAPC2 PE=1 SV=1
6	Q9W1E5	9.87e-175	525	802	0.350	0.359	Q9W1E5_DROME Anaphase-promoting complex subunit 2 OS=Drosophila melanogaster OX=7227 GN=mr PE=1 SV=1
7	Q95TK2	2.16e-140	424	449	0.259	0.474	Q95TK2_DROME Anaphase-promoting complex subunit 2 OS=Drosophila melanogaster OX=7227 GN=mr PE=2 SV=1
8	Q8H1U5	6.80e-113	366	865	0.246	0.234	APC2_ARATH Anaphase-promoting complex subunit 2 OS=Arabidopsis thaliana OX=3702 GN=APC2 PE=1 SV=1
9	Q551S9	1.68e-97	326	907	0.290	0.262	APC2_DICDI Anaphase-promoting complex subunit 2 OS=Dictyostelium discoideum OX=44689 GN=anapc2 PE=3 SV=1
10	Q874R3	6.43e-66	234	681	0.209	0.253	APC2_SCHPO Anaphase-promoting complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=apc2 PE=1 SV=1
11	P34514	1.35e-55	206	731	0.181	0.204	ANC2_CAEEL Anaphase-promoting complex subunit 2 OS=Caenorhabditis elegans OX=6239 GN=apc-2 PE=1 SV=3
12	Q38DN8	5.04e-33	139	770	0.204	0.218	Q38DN8_TRYB2 Anaphase-promoting complex subunit 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.2660 PE=3 SV=1
13	Q12440	5.88e-27	120	853	0.187	0.181	APC2_YEAST Anaphase-promoting complex subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=APC2 PE=1 SV=1
14	Q5ZC88	3.03e-12	72.8	744	0.063	0.070	CUL1_ORYSJ Cullin-1 OS=Oryza sativa subsp. japonica OX=39947 GN=CUL1 PE=1 SV=1
15	O14122	7.56e-11	68.2	734	0.060	0.067	CUL4_SCHPO Cullin-4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pcu4 PE=1 SV=1
16	Q09760	7.59e-11	68.2	785	0.069	0.073	CUL3_SCHPO Cullin-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cul3 PE=1 SV=2
17	Q94AH6	8.92e-11	68.2	738	0.060	0.066	CUL1_ARATH Cullin-1 OS=Arabidopsis thaliana OX=3702 GN=CUL1 PE=1 SV=1
18	Q3TCH7	1.50e-10	67.4	759	0.064	0.070	CUL4A_MOUSE Cullin-4A OS=Mus musculus OX=10090 GN=Cul4a PE=1 SV=1
19	Q8LGH4	2.48e-10	66.6	792	0.063	0.066	CUL4_ARATH Cullin-4 OS=Arabidopsis thaliana OX=3702 GN=CUL4 PE=1 SV=1
20	Q13619	4.39e-10	65.9	759	0.063	0.069	CUL4A_HUMAN Cullin-4A OS=Homo sapiens OX=9606 GN=CUL4A PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08672 ANAPC2	2.9e-17	74.2	Anaphase promoting complex (APC) subunit 2
2	PF00888 Cullin	2.4e-27	107.5	Cullin family
3	PF18892 DUF5651	9.4e+02	11.1	Family of unknown function (DUF5651)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000314004

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261819	0.999	Anaphase-promoting complex subunit 5
2	9606.ENSP00000339109	0.999	Anaphase-promoting complex subunit 1
3	9606.ENSP00000349957	0.999	Anaphase promoting complex subunit 11
4	9606.ENSP00000353549	0.999	Cell division cycle protein 16 homolog
5	9606.ENSP00000361540	0.999	Cell division cycle protein 20 homolog
6	9606.ENSP00000363322	0.999	Anaphase-promoting complex subunit CDC26
7	9606.ENSP00000378350	0.999	Cell division cycle protein 23 homolog
8	9606.ENSP00000378529	0.999	Fizzy-related protein homolog
9	9606.ENSP00000394394	0.999	Anaphase-promoting complex subunit 7
10	9606.ENSP00000426654	0.999	Anaphase-promoting complex subunit 4
11	9606.ENSP00000434614	0.999	Cell division cycle protein 27 homolog
12	9606.ENSP00000478501	0.999	Anaphase-promoting complex subunit 10
13	9606.ENSP00000421842	0.998	Anaphase-promoting complex subunit 13
14	9606.ENSP00000439403	0.998	Anaphase-promoting complex subunit 15
15	9606.ENSP00000477760	0.998	Anaphase-promoting complex subunit 16
16	9606.ENSP00000348838	0.997	Ubiquitin-conjugating enzyme E2 C
17	9606.ENSP00000377536	0.996	Securin
18	9606.ENSP00000229758	0.981	F-box only protein 5
19	9606.ENSP00000264552	0.978	Ubiquitin-conjugating enzyme E2 S
20	9606.ENSP00000296509	0.972	Mitotic spindle assembly checkpoint protein MAD2A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.986	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0009987	0.968	cellular process
GO:0071704	0.967	organic substance metabolic process
GO:0044238	0.965	primary metabolic process
GO:0060255	0.957	regulation of macromolecule metabolic process
GO:0006807	0.956	nitrogen compound metabolic process
GO:0071840	0.954	cellular component organization or biogenesis
GO:0048519	0.950	negative regulation of biological process
GO:0048518	0.947	positive regulation of biological process
GO:0043170	0.943	macromolecule metabolic process
GO:0048522	0.938	positive regulation of cellular process
GO:0010605	0.930	negative regulation of macromolecule metabolic process
GO:0010468	0.929	regulation of gene expression
GO:0016043	0.928	cellular component organization
GO:0019538	0.920	protein metabolic process
GO:0051128	0.915	regulation of cellular component organization
GO:0016567	0.904	protein ubiquitination
GO:0022603	0.870	regulation of anatomical structure morphogenesis
GO:0010720	0.864	positive regulation of cell development
GO:0051239	0.858	regulation of multicellular organismal process
GO:2000026	0.835	regulation of multicellular organismal development
GO:0010975	0.827	regulation of neuron projection development
GO:0051962	0.806	positive regulation of nervous system development
GO:0000209	0.785	protein polyubiquitination
GO:0050769	0.784	positive regulation of neurogenesis
GO:0031346	0.773	positive regulation of cell projection organization
GO:0050773	0.753	regulation of dendrite development
GO:0008361	0.731	regulation of cell size
GO:0050772	0.730	positive regulation of axonogenesis
GO:0045773	0.722	positive regulation of axon extension
GO:0010769	0.718	regulation of cell morphogenesis involved in differentiation
GO:0010629	0.701	negative regulation of gene expression
GO:0010770	0.666	positive regulation of cell morphogenesis involved in differentiation
GO:0044237	0.546	cellular metabolic process
GO:0048814	0.533	regulation of dendrite morphogenesis
GO:0050775	0.361	positive regulation of dendrite morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0032991	0.996	protein-containing complex
GO:0031981	0.990	nuclear lumen
GO:0005654	0.980	nucleoplasm
GO:0005829	0.971	cytosol
GO:0000151	0.959	ubiquitin ligase complex
GO:0140513	0.929	nuclear protein-containing complex
GO:0031461	0.914	cullin-RING ubiquitin ligase complex
GO:0000152	0.912	nuclear ubiquitin ligase complex
GO:0005680	0.464	anaphase-promoting complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]