StarFunc result for job id Q9UJY1

User Input

>input (196 residues)
MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAW
PGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVE
VSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGES
SFNNELPQDSQEVTCT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9JK92	0.464	0.464	1.345E-28	196	0.944	0.944	Q9JK92.pdb.gz	HSPB8_MOUSE Heat shock protein beta-8 OS=Mus musculus OX=10090 GN=Hspb8 PE=1 SV=1
2	AFDB:Q00649	0.393	0.399	3.831E-12	193	0.362	0.368	Q00649.pdb.gz	HSPB1_CHICK Heat shock protein beta-1 OS=Gallus gallus OX=9031 GN=HSPB1 PE=2 SV=1
3	AFDB:P15991	0.384	0.354	9.572E-12	213	0.383	0.352	P15991.pdb.gz	HSPB1_CRILO Heat shock protein beta-1 OS=Cricetulus longicaudatus OX=10030 GN=HSPB1 PE=1 SV=1
4	AFDB:P04792	0.379	0.363	1.257E-10	205	0.383	0.366	P04792.pdb.gz	HSPB1_HUMAN Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2
5	AFDB:A4VAK4	0.391	0.385	7.414E-10	199	0.362	0.357	A4VAK4.pdb.gz	A4VAK4_DANRE Heat shock protein beta-1 OS=Danio rerio OX=7955 GN=hsp1 PE=1 SV=1
6	AFDB:P02510	0.374	0.417	1.107E-9	175	0.158	0.177	P02510.pdb.gz	CRYAB_BOVIN Alpha-crystallin B chain OS=Bos taurus OX=9913 GN=CRYAB PE=1 SV=2
7	AFDB:P82147	0.373	0.390	1.107E-9	187	0.214	0.225	P82147.pdb.gz	L2EFL_DROME Protein lethal(2)essential for life OS=Drosophila melanogaster OX=7227 GN=l(2)efl PE=1 SV=1
8	AFDB:P02470	0.366	0.412	2.928E-9	173	0.153	0.173	P02470.pdb.gz	CRYAA_BOVIN Alpha-crystallin A chain OS=Bos taurus OX=9913 GN=CRYAA PE=1 SV=1
9	AFDB:Q68DG0	0.343	0.384	3.101E-9	174	0.230	0.259	Q68DG0.pdb.gz	Q68DG0_HUMAN Heat shock protein family B (small) member 7 OS=Homo sapiens OX=9606 GN=HSPB7 PE=1 SV=1
10	AFDB:O35878	0.375	0.402	4.901E-9	182	0.168	0.181	O35878.pdb.gz	HSPB2_RAT Heat shock protein beta-2 OS=Rattus norvegicus OX=10116 GN=Hspb2 PE=3 SV=1
11	PDB:5ltwL	0.364	0.686	1.053E-8	100	0.194	0.380	5ltwL.pdb.gz
12	PDB:6f2rA	0.363	0.533	1.763E-8	130	0.173	0.262	6f2rA.pdb.gz	Terminal Regions Confer Plasticity to the Tetrameric Assembly of Human HspB2 and HspB3.
13	PDB:5ltwG	0.364	0.587	1.384E-7	118	0.209	0.347	5ltwG.pdb.gz
14	PDB:4ydzA	0.363	0.518	1.552E-7	135	0.143	0.207	4ydzA.pdb.gz
15	PDB:6dv5A	0.338	0.363	2.912E-7	181	0.219	0.238	6dv5A.pdb.gz
16	PDB:2ygdA	0.331	0.367	4.347E-7	175	0.168	0.189	2ygdA.pdb.gz
17	PDB:6t1rA	0.328	0.380	1.717E-6	166	0.143	0.169	6t1rA.pdb.gz
18	PDB:6f2rQ	0.339	0.710	4.543E-6	89	0.117	0.258	6f2rQ.pdb.gz	Terminal Regions Confer Plasticity to the Tetrameric Assembly of Human HspB2 and HspB3.
19	PDB:3w1zB	0.353	0.470	1.256E-4	143	0.112	0.154	3w1zB.pdb.gz
20	PDB:1gmeA	0.346	0.441	2.226E-4	150	0.107	0.140	1gmeA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UJY1	1.64e-144	401	196	1.000	1.000	HSPB8_HUMAN Heat shock protein beta-8 OS=Homo sapiens OX=9606 GN=HSPB8 PE=1 SV=1
2	Q9JK92	4.99e-136	380	196	0.944	0.944	HSPB8_MOUSE Heat shock protein beta-8 OS=Mus musculus OX=10090 GN=Hspb8 PE=1 SV=1
3	Q00649	1.13e-30	112	193	0.362	0.368	HSPB1_CHICK Heat shock protein beta-1 OS=Gallus gallus OX=9031 GN=HSPB1 PE=2 SV=1
4	P42930	1.38e-30	112	206	0.388	0.369	HSPB1_RAT Heat shock protein beta-1 OS=Rattus norvegicus OX=10116 GN=Hspb1 PE=1 SV=1
5	P14602	1.06e-29	110	209	0.378	0.354	HSPB1_MOUSE Heat shock protein beta-1 OS=Mus musculus OX=10090 GN=Hspb1 PE=1 SV=3
6	P04792	1.60e-29	110	205	0.367	0.351	HSPB1_HUMAN Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2
7	A4VAK4	8.89e-28	105	199	0.337	0.332	A4VAK4_DANRE Heat shock protein beta-1 OS=Danio rerio OX=7955 GN=hsp1 PE=1 SV=1
8	P15991	4.17e-27	104	213	0.367	0.338	HSPB1_CRILO Heat shock protein beta-1 OS=Cricetulus longicaudatus OX=10030 GN=HSPB1 PE=1 SV=1
9	P82147	3.61e-24	95.9	187	0.311	0.326	L2EFL_DROME Protein lethal(2)essential for life OS=Drosophila melanogaster OX=7227 GN=l(2)efl PE=1 SV=1
10	P02511	3.08e-18	80.1	175	0.286	0.320	CRYAB_HUMAN Alpha-crystallin B chain OS=Homo sapiens OX=9606 GN=CRYAB PE=1 SV=2
11	V9HW27	3.08e-18	80.1	175	0.286	0.320	V9HW27_HUMAN Alpha-crystallin B chain OS=Homo sapiens OX=9606 GN=HEL-S-101 PE=1 SV=1
12	P23927	4.01e-18	79.7	175	0.281	0.314	CRYAB_MOUSE Alpha-crystallin B chain OS=Mus musculus OX=10090 GN=Cryab PE=1 SV=2
13	P23928	4.14e-18	79.7	175	0.281	0.314	CRYAB_RAT Alpha-crystallin B chain OS=Rattus norvegicus OX=10116 GN=Cryab PE=1 SV=1
14	P02510	8.57e-18	79.0	175	0.281	0.314	CRYAB_BOVIN Alpha-crystallin B chain OS=Bos taurus OX=9913 GN=CRYAB PE=1 SV=2
15	P02470	8.37e-16	73.6	173	0.230	0.260	CRYAA_BOVIN Alpha-crystallin A chain OS=Bos taurus OX=9913 GN=CRYAA PE=1 SV=1
16	E7EWH7	1.71e-15	72.4	153	0.230	0.294	E7EWH7_HUMAN Crystallin alpha A OS=Homo sapiens OX=9606 GN=CRYAA PE=1 SV=1
17	Q8UUZ6	1.74e-15	72.8	173	0.158	0.179	Q8UUZ6_DANRE Alpha A crystallin OS=Danio rerio OX=7955 GN=wu:fc06h04 PE=1 SV=1
18	P02489	2.13e-15	72.4	173	0.230	0.260	CRYAA_HUMAN Alpha-crystallin A chain OS=Homo sapiens OX=9606 GN=CRYAA PE=1 SV=2
19	Q9PUR2	1.82e-14	70.1	168	0.148	0.173	Q9PUR2_DANRE Alpha b crystallin OS=Danio rerio OX=7955 GN=cryab PE=1 SV=1
20	P97541	2.60e-14	69.3	162	0.158	0.191	HSPB6_RAT Heat shock protein beta-6 OS=Rattus norvegicus OX=10116 GN=Hspb6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00011 HSP20	2.4e-13	61.5	Hsp20/alpha crystallin family
2	PF07873 YabP	94	14.2	YabP family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000000259

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000020325	0.993	BCL2-associated athanogene 3
2	61853.ENSNLEP00000009039	0.908	Belongs to the heat shock protein 70 family.
3	61853.ENSNLEP00000009975	0.877	STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase
4	61853.ENSNLEP00000007762	0.848	Uncharacterized protein
5	61853.ENSNLEP00000004793	0.845	Chaperonin containing TCP1 subunit 2
6	61853.ENSNLEP00000011878	0.838	T-complex protein 1 subunit delta
7	61853.ENSNLEP00000015267	0.836	T-complex protein 1 subunit gamma
8	61853.ENSNLEP00000013680	0.834	T-complex 1
9	61853.ENSNLEP00000013874	0.809	Heat shock protein 90kDa alpha (cytosolic), class B member 1
10	61853.ENSNLEP00000007754	0.806	Uncharacterized protein
11	61853.ENSNLEP00000019365	0.802	Heat shock protein 90kDa alpha (cytosolic), class A member 1
12	61853.ENSNLEP00000016395	0.788	DnaJ (Hsp40) homolog, subfamily B, member 1
13	61853.ENSNLEP00000015709	0.781	Heat shock 70kDa protein 4
14	61853.ENSNLEP00000003393	0.773	BCL2-associated athanogene 2
15	61853.ENSNLEP00000012815	0.751	Heat shock transcription factor 1
16	61853.ENSNLEP00000008882	0.749	Crystallin, alpha B
17	61853.ENSNLEP00000005830	0.707	Stress-induced phosphoprotein 1
18	61853.ENSNLEP00000010416	0.697	Myotilin
19	61853.ENSNLEP00000004035	0.689	Chaperonin containing TCP1 subunit 8
20	61853.ENSNLEP00000012817	0.688	Chaperonin containing TCP1 subunit 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.444	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0048518	0.987	positive regulation of biological process
GO:0031323	0.985	regulation of cellular metabolic process
GO:0050896	0.979	response to stimulus
GO:0006986	0.958	response to unfolded protein
GO:0048522	0.925	positive regulation of cellular process
GO:0009894	0.917	regulation of catabolic process
GO:0031329	0.873	regulation of cellular catabolic process
GO:0010506	0.863	regulation of autophagy
GO:0031331	0.858	positive regulation of cellular catabolic process
GO:0016239	0.827	positive regulation of macroautophagy
GO:0051716	0.795	cellular response to stimulus
GO:0033554	0.371	cellular response to stress
GO:0080090	0.349	regulation of primary metabolic process
GO:0060255	0.346	regulation of macromolecule metabolic process
GO:0051171	0.335	regulation of nitrogen compound metabolic process
GO:0070887	0.303	cellular response to chemical stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.998	nucleoplasm
GO:0032991	0.995	protein-containing complex
GO:0005829	0.992	cytosol
GO:0140535	0.983	intracellular protein-containing complex
GO:0101031	0.952	chaperone complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]