StarFunc result for job id Q9UJY5

User Input

>input (639 residues)
MEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQE
WEAIQALTVLETCMKSCGKRFHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILELLY
SWTVGLPEEVKIAEAYQMLKKQGIVKSDPKLPDDTTFPLPPPRPKNVIFEDEEKSKMLAR
LLKSSHPEDLRAANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSQGGA
AAGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVRG
EEVNGDATAGSIPGSTSALLDLSGLDLPPAGTTYPAMPTRPGEQASPEQPSASVSLLDDE
LMSLGLSDPTPPSGPSLDGTGWNSFQSSDATEPPAPALAQAPSMESRPPAQTSLPASSGL
DDLDLLGKTLLQQSLPPESQQVRWEKQQPTPRLTLRDLQNKSSSCSSPSSSATSLLHTVS
PEPPRPPQQPVPTELSLASITVPLESIKPSNILPVTVYDQHGFRILFHFARDPLPGRSDV
LVVVVSMLSTAPQPIRNIVFQSAVPKVMKVKLQPPSGTELPAFNPIVHPSAITQVLLLAN
PQKEKVRLRYKLTFTMGDQTYNEMGDVDQFPPPETWGSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UJY5	1.000	1.000	9.478E-95	639	1.000	1.000	Q9UJY5.pdb.gz	GGA1_HUMAN ADP-ribosylation factor-binding protein GGA1 OS=Homo sapiens OX=9606 GN=GGA1 PE=1 SV=1
2	AFDB:A0A0G2JV04	0.381	0.344	4.396E-58	727	0.567	0.498	A0A0G2JV04.pdb.gz	GGA3_RAT ADP-ribosylation factor-binding protein GGA3 OS=Rattus norvegicus OX=10116 GN=Gga3 PE=1 SV=1
3	AFDB:Q9NZ52	0.385	0.350	3.255E-57	723	0.563	0.498	Q9NZ52.pdb.gz	GGA3_HUMAN ADP-ribosylation factor-binding protein GGA3 OS=Homo sapiens OX=9606 GN=GGA3 PE=1 SV=1
4	AFDB:Q9UJY4	0.379	0.392	4.444E-53	613	0.457	0.476	Q9UJY4.pdb.gz	GGA2_HUMAN ADP-ribosylation factor-binding protein GGA2 OS=Homo sapiens OX=9606 GN=GGA2 PE=1 SV=3
5	AFDB:Q6P5E6	0.285	0.299	1.731E-51	603	0.448	0.474	Q6P5E6.pdb.gz	GGA2_MOUSE ADP-ribosylation factor-binding protein GGA2 OS=Mus musculus OX=10090 GN=Gga2 PE=1 SV=1
6	AFDB:F4JV51	0.206	0.195	1.469E-10	676	0.182	0.172	F4JV51.pdb.gz	F4JV51_ARATH ENTH/VHS/GAT family protein OS=Arabidopsis thaliana OX=3702 GN=At4g32760 PE=1 SV=1
7	AFDB:B5DFK6	0.145	0.080	4.906E-8	1204	0.150	0.080	B5DFK6.pdb.gz	B5DFK6_RAT Adaptor related protein complex 3 subunit delta 1 OS=Rattus norvegicus OX=10116 GN=Ap3d1 PE=1 SV=1
8	PDB:5a1uE	0.149	0.119	7.210E-6	824	0.128	0.100	5a1uE.pdb.gz
9	AFDB:Q0GNC1	0.145	0.079	1.537E-3	1273	0.158	0.079	Q0GNC1.pdb.gz	INF2_MOUSE Inverted formin-2 OS=Mus musculus OX=10090 GN=Inf2 PE=1 SV=1
10	AFDB:Q9C9H8	0.098	0.077	2.060E-3	909	0.116	0.081	Q9C9H8.pdb.gz	SCY2B_ARATH SCY1-like protein 2 B OS=Arabidopsis thaliana OX=3702 GN=SCYL2B PE=1 SV=1
11	PDB:5nzrK	0.148	0.167	3.558E-3	560	0.039	0.045	5nzrK.pdb.gz
12	PDB:7oo3c	0.185	0.724	3.736E-3	141	0.036	0.163	7oo3c.pdb.gz	Structural basis of human transcription-DNA repair coupling.
13	PDB:3gniA	0.113	0.190	4.325E-3	335	0.069	0.131	3gniA.pdb.gz	ATP and MO25alpha regulate the conformational state of the STRADalpha pseudokinase and activation of the LKB1 tumour suppressor
14	AFDB:Q9VS24	0.082	0.064	8.912E-3	994	0.111	0.071	Q9VS24.pdb.gz	MELT_DROME Protein melted OS=Drosophila melanogaster OX=7227 GN=melt PE=1 SV=2
15	PDB:3zhpA	0.114	0.203	1.540E-2	315	0.063	0.127	3zhpA.pdb.gz
16	PDB:5dfkA	0.087	0.225	1.698E-2	185	0.011	0.038	5dfkA.pdb.gz
17	PDB:4tnmA	0.103	0.143	2.064E-2	407	0.064	0.101	4tnmA.pdb.gz
18	PDB:3tpoA	0.134	0.179	3.363E-2	438	0.080	0.116	3tpoA.pdb.gz
19	PDB:4lk4A	0.108	0.200	4.088E-2	326	0.011	0.021	4lk4A.pdb.gz
20	PDB:6cplA	0.091	0.233	4.733E-2	180	0.023	0.083	6cplA.pdb.gz	CD4+T cell-mediated HLA class II cross-restriction in HIV controllers.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BMI3	0.0	621	718	0.570	0.507	GGA3_MOUSE ADP-ribosylation factor-binding protein GGA3 OS=Mus musculus OX=10090 GN=Gga3 PE=1 SV=2
2	Q8R0H9	0.0	1127	635	0.909	0.915	GGA1_MOUSE ADP-ribosylation factor-binding protein GGA1 OS=Mus musculus OX=10090 GN=Gga1 PE=1 SV=1
3	Q9UJY5	0.0	1298	639	1.000	1.000	GGA1_HUMAN ADP-ribosylation factor-binding protein GGA1 OS=Homo sapiens OX=9606 GN=GGA1 PE=1 SV=1
4	Q9UJY4	7.28e-168	494	613	0.480	0.501	GGA2_HUMAN ADP-ribosylation factor-binding protein GGA2 OS=Homo sapiens OX=9606 GN=GGA2 PE=1 SV=3
5	Q6P5E6	6.98e-166	489	603	0.455	0.483	GGA2_MOUSE ADP-ribosylation factor-binding protein GGA2 OS=Mus musculus OX=10090 GN=Gga2 PE=1 SV=1
6	A0A0G2JV04	2.74e-138	422	727	0.366	0.322	GGA3_RAT ADP-ribosylation factor-binding protein GGA3 OS=Rattus norvegicus OX=10116 GN=Gga3 PE=1 SV=1
7	Q9NZ52	1.38e-128	397	723	0.354	0.313	GGA3_HUMAN ADP-ribosylation factor-binding protein GGA3 OS=Homo sapiens OX=9606 GN=GGA3 PE=1 SV=1
8	J3KSS7	1.58e-91	298	632	0.283	0.286	J3KSS7_HUMAN Golgi associated, gamma adaptin ear containing, ARF binding protein 3 OS=Homo sapiens OX=9606 GN=GGA3 PE=1 SV=1
9	Q95RK8	1.67e-39	154	505	0.149	0.188	Q95RK8_DROME LD22310p OS=Drosophila melanogaster OX=7227 GN=Gga PE=2 SV=1
10	Q9W329	3.77e-39	155	660	0.149	0.144	Q9W329_DROME Golgi-localized, gamma-adaptin ear containing, ARF binding protein OS=Drosophila melanogaster OX=7227 GN=Gga PE=1 SV=2
11	Q23165	3.18e-33	137	588	0.205	0.223	Q23165_CAEEL ADP-ribosylation factor-binding protein GGA1 OS=Caenorhabditis elegans OX=6239 GN=apt-9 PE=1 SV=2
12	Q6ZVM7	1.50e-19	94.7	507	0.174	0.219	TM1L2_HUMAN TOM1-like protein 2 OS=Homo sapiens OX=9606 GN=TOM1L2 PE=1 SV=1
13	O88746	5.00e-19	92.8	492	0.144	0.187	TOM1_MOUSE Target of Myb1 membrane trafficking protein OS=Mus musculus OX=10090 GN=Tom1 PE=1 SV=1
14	O60784	2.05e-18	90.9	492	0.135	0.175	TOM1_HUMAN Target of Myb1 membrane trafficking protein OS=Homo sapiens OX=9606 GN=TOM1 PE=1 SV=2
15	Q7ZUU8	2.73e-15	82.0	819	0.083	0.065	Q7ZUU8_DANRE AP-1 complex subunit gamma OS=Danio rerio OX=7955 GN=adtg PE=1 SV=1
16	B3KNW1	2.80e-15	78.2	247	0.064	0.166	B3KNW1_HUMAN Adaptor related protein complex 1 subunit gamma 1 OS=Homo sapiens OX=9606 GN=AP1G1 PE=1 SV=1
17	O75674	1.03e-14	79.3	476	0.102	0.137	TM1L1_HUMAN TOM1-like protein 1 OS=Homo sapiens OX=9606 GN=TOM1L1 PE=1 SV=2
18	Q923U0	3.23e-14	77.8	474	0.102	0.137	TM1L1_MOUSE TOM1-like protein 1 OS=Mus musculus OX=10090 GN=Tom1l1 PE=1 SV=1
19	A0A140VJE7	3.37e-14	78.6	825	0.069	0.053	A0A140VJE7_HUMAN AP-1 complex subunit gamma OS=Homo sapiens OX=9606 PE=2 SV=1
20	Q8R525	3.38e-14	76.3	310	0.063	0.129	Q8R525_RAT Gamma-adaptin (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02883 Alpha_adaptinC2	6.4e-27	105.4	Adaptin C-terminal domain
2	PF14796 AP3B1_C	1.5e+02	14.0	Clathrin-adaptor complex-3 beta-1 subunit C-terminal
3	PF17959 EF-hand_14	4.9e+02	12.4	EF-hand domain
4	PF07011 Elf4	41	15.5	Early Flowering 4 domain
5	PF00210 Ferritin	74	14.8	Ferritin-like domain
6	PF03127 GAT	5.4e-21	86.0	GAT domain
7	PF18308 GGA_N-GAT	8.6e-18	75.0	N-terminal extension of GAT domain
8	PF08673 RsbU_N	7.1e+02	11.7	Phosphoserine phosphatase RsbU, N-terminal domain
9	PF00790 VHS	1.4e-36	136.9	VHS domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000341344

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000318585	0.999	Beta-secretase 1
2	9606.ENSP00000349437	0.999	Cation-independent mannose-6-phosphate receptor
3	9606.ENSP00000445408	0.999	Rab GTPase-binding effector protein 1
4	9606.ENSP00000260197	0.995	Sortilin-related receptor
5	9606.ENSP00000440005	0.995	ADP-ribosylation factor 1
6	9606.ENSP00000256637	0.994	Sortilin
7	9606.ENSP00000311962	0.986	ADP-ribosylation factor-binding protein GGA2
8	9606.ENSP00000438040	0.977	Coiled-coil domain-containing protein 91
9	9606.ENSP00000438085	0.975	ADP-ribosylation factor-binding protein GGA3
10	9606.ENSP00000479606	0.954	Clathrin heavy chain 1
11	9606.ENSP00000000412	0.946	Cation-dependent mannose-6-phosphate receptor
12	9606.ENSP00000370208	0.923	RAB guanine nucleotide exchange factor 1
13	9606.ENSP00000441543	0.919	Polyubiquitin-C
14	9606.ENSP00000256682	0.918	ADP-ribosylation factor 3
15	9606.ENSP00000298316	0.826	ADP-ribosylation factor 6
16	9606.ENSP00000483453	0.810	Synergin gamma
17	9606.ENSP00000217244	0.806	Casein kinase II subunit alpha
18	9606.ENSP00000273047	0.783	Ras-related protein Rab-5A
19	9606.ENSP00000262506	0.769	Casein kinase II subunit alpha
20	9606.ENSP00000284981	0.760	Amyloid-beta A4 protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.989	enzyme binding
GO:0031267	0.976	small GTPase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0008104	0.992	protein localization
GO:0006892	0.988	post-Golgi vesicle-mediated transport
GO:0098876	0.975	vesicle-mediated transport to the plasma membrane
GO:1990778	0.964	protein localization to cell periphery
GO:0016197	0.915	endosomal transport
GO:0006893	0.887	Golgi to plasma membrane transport
GO:0050789	0.848	regulation of biological process
GO:0015031	0.819	protein transport
GO:0061951	0.771	establishment of protein localization to plasma membrane
GO:0043001	0.732	Golgi to plasma membrane protein transport
GO:0016482	0.697	cytosolic transport
GO:0008152	0.484	metabolic process
GO:0019222	0.451	regulation of metabolic process
GO:0048518	0.446	positive regulation of biological process
GO:0060255	0.430	regulation of macromolecule metabolic process
GO:0034394	0.420	protein localization to cell surface
GO:0050794	0.413	regulation of cellular process
GO:0071704	0.384	organic substance metabolic process
GO:0044238	0.378	primary metabolic process
GO:0080090	0.377	regulation of primary metabolic process
GO:0051171	0.314	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	0.999	Golgi apparatus
GO:0005769	0.998	early endosome
GO:0010008	0.997	endosome membrane
GO:0070013	0.995	intracellular organelle lumen
GO:0005654	0.994	nucleoplasm
GO:0032991	0.992	protein-containing complex
GO:0031901	0.975	early endosome membrane
GO:0005829	0.700	cytosol
GO:0071944	0.422	cell periphery
GO:0031984	0.418	organelle subcompartment
GO:0005886	0.410	plasma membrane
GO:0005802	0.396	trans-Golgi network

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]