StarFunc result for job id Q9UK05

User Input

>input (429 residues)
MCPGALWVALPLLSLLAGSLQGKPLQSWGRGSAGGNAHSPLGVPGGGLPEHTFNLKMFLE
NVKVDFLRSLNLSGVPSQDKTRVEPPQYMIDLYNRYTSDKSTTPASNIVRSFSMEDAISI
TATEDFPFQKHILLFNISIPRHEQITRAELRLYVSCQNHVDPSHDLKGSVVIYDVLDGTD
AWDSATETKTFLVSQDIQDEGWETLEVSSAVKRWVRSDSTKSKNKLEVTVESHRKGCDTL
DISVPPGSRNLPFFVVFSNDHSSGTKETRLELREMISHEQESVLKKLSKDGSTEAGESSH
EEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGC
FFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEG
MSVAECGCR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UK05	1.000	1.000	4.230E-77	429	1.000	1.000	Q9UK05.pdb.gz	GDF2_HUMAN Growth/differentiation factor 2 OS=Homo sapiens OX=9606 GN=GDF2 PE=1 SV=1
2	AFDB:Q9WV56	0.695	0.696	2.581E-62	428	0.802	0.804	Q9WV56.pdb.gz	GDF2_MOUSE Growth/differentiation factor 2 OS=Mus musculus OX=10090 GN=Gdf2 PE=1 SV=2
3	AFDB:Q4AEG6	0.626	0.638	1.154E-37	421	0.392	0.399	Q4AEG6.pdb.gz	BMP10_RAT Bone morphogenetic protein 10 OS=Rattus norvegicus OX=10116 GN=Bmp10 PE=2 SV=1
4	AFDB:Q70GM8	0.637	0.709	4.660E-37	383	0.380	0.426	Q70GM8.pdb.gz	Q70GM8_CHICK Bone morphogenetic protein-10 (Fragment) OS=Gallus gallus OX=9031 GN=BMP-10 PE=2 SV=1
5	AFDB:O95393	0.630	0.637	1.225E-36	424	0.406	0.410	O95393.pdb.gz	BMP10_HUMAN Bone morphogenetic protein 10 OS=Homo sapiens OX=9606 GN=BMP10 PE=1 SV=1
6	AFDB:A2BGK2	0.620	0.552	1.373E-35	485	0.394	0.348	A2BGK2.pdb.gz	A2BGK2_DANRE Bone morphogenetic protein 10 OS=Danio rerio OX=7955 GN=si:dkey-13n15.5 PE=2 SV=1
7	AFDB:F1QWZ4	0.613	0.673	9.488E-35	389	0.354	0.391	F1QWZ4.pdb.gz	GDF2_DANRE Growth/differentiation factor 2 OS=Danio rerio OX=7955 GN=gdf2 PE=2 SV=1
8	AFDB:A0A2R8RLC3	0.595	0.627	6.005E-31	406	0.319	0.337	A0A2R8RLC3.pdb.gz
9	AFDB:C8C060	0.585	0.630	1.995E-27	396	0.280	0.303	C8C060.pdb.gz	C8C060_HUMAN Bone morphogenetic protein 2 OS=Homo sapiens OX=9606 GN=BMP2 PE=3 SV=1
10	AFDB:P34821	0.571	0.610	3.413E-27	399	0.277	0.298	P34821.pdb.gz	BMP8A_MOUSE Bone morphogenetic protein 8A OS=Mus musculus OX=10090 GN=Bmp8a PE=2 SV=1
11	PDB:5hlyA	0.239	0.325	3.620E-14	299	0.177	0.254	5hlyA.pdb.gz
12	PDB:5ntuA	0.230	0.305	9.518E-14	308	0.184	0.256	5ntuA.pdb.gz
13	PDB:6umxA	0.262	0.380	3.102E-13	279	0.177	0.272	6umxA.pdb.gz
14	PDB:5nxsA	0.250	0.350	5.029E-13	290	0.184	0.272	5nxsA.pdb.gz
15	PDB:3rjrC	0.227	0.274	3.476E-12	343	0.170	0.213	3rjrC.pdb.gz
16	PDB:5vqfB	0.234	0.301	6.274E-12	320	0.159	0.212	5vqfB.pdb.gz
17	PDB:5ffoG	0.236	0.325	1.573E-10	297	0.163	0.236	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
18	PDB:5nxsB	0.208	0.323	6.356E-10	251	0.161	0.275	5nxsB.pdb.gz
19	PDB:7y1rB	0.187	0.248	5.445E-9	308	0.168	0.234	7y1rB.pdb.gz
20	PDB:7chjB	0.107	0.177	2.971E-3	226	0.061	0.115	7chjB.pdb.gz	Molecular basis for cysteine oxidation by plant cysteine oxidases from Arabidopsis thaliana.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UK05	0.0	892	429	1.000	1.000	GDF2_HUMAN Growth/differentiation factor 2 OS=Homo sapiens OX=9606 GN=GDF2 PE=1 SV=1
2	Q9WV56	0.0	721	428	0.802	0.804	GDF2_MOUSE Growth/differentiation factor 2 OS=Mus musculus OX=10090 GN=Gdf2 PE=1 SV=2
3	Q70GM8	5.17e-103	313	383	0.396	0.444	Q70GM8_CHICK Bone morphogenetic protein-10 (Fragment) OS=Gallus gallus OX=9031 GN=BMP-10 PE=2 SV=1
4	O95393	4.68e-101	309	424	0.399	0.403	BMP10_HUMAN Bone morphogenetic protein 10 OS=Homo sapiens OX=9606 GN=BMP10 PE=1 SV=1
5	Q4AEG6	8.25e-101	308	421	0.389	0.397	BMP10_RAT Bone morphogenetic protein 10 OS=Rattus norvegicus OX=10116 GN=Bmp10 PE=2 SV=1
6	Q9R229	2.51e-99	305	421	0.387	0.394	BMP10_MOUSE Bone morphogenetic protein 10 OS=Mus musculus OX=10090 GN=Bmp10 PE=1 SV=2
7	A2BGK2	1.85e-93	291	485	0.392	0.346	A2BGK2_DANRE Bone morphogenetic protein 10 OS=Danio rerio OX=7955 GN=si:dkey-13n15.5 PE=2 SV=1
8	F1QWZ4	1.23e-92	286	389	0.364	0.401	GDF2_DANRE Growth/differentiation factor 2 OS=Danio rerio OX=7955 GN=gdf2 PE=2 SV=1
9	P12644	2.04e-40	150	408	0.308	0.324	BMP4_HUMAN Bone morphogenetic protein 4 OS=Homo sapiens OX=9606 GN=BMP4 PE=1 SV=1
10	P49001	1.22e-39	148	393	0.275	0.300	BMP2_RAT Bone morphogenetic protein 2 OS=Rattus norvegicus OX=10116 GN=Bmp2 PE=2 SV=1
11	P21274	1.61e-39	148	394	0.294	0.320	BMP2_MOUSE Bone morphogenetic protein 2 OS=Mus musculus OX=10090 GN=Bmp2 PE=1 SV=3
12	C8C060	2.60e-39	147	396	0.284	0.308	C8C060_HUMAN Bone morphogenetic protein 2 OS=Homo sapiens OX=9606 GN=BMP2 PE=3 SV=1
13	P12643	2.60e-39	147	396	0.284	0.308	BMP2_HUMAN Bone morphogenetic protein 2 OS=Homo sapiens OX=9606 GN=BMP2 PE=1 SV=1
14	A5HMF9	2.73e-39	147	404	0.284	0.302	A5HMF9_ANAPL Bone morphogenetic protein 4 OS=Anas platyrhynchos OX=8839 GN=BMP4 PE=3 SV=1
15	Q06826	4.63e-39	147	408	0.301	0.316	BMP4_RAT Bone morphogenetic protein 4 OS=Rattus norvegicus OX=10116 GN=Bmp4 PE=2 SV=1
16	P21275	8.63e-39	146	408	0.301	0.316	BMP4_MOUSE Bone morphogenetic protein 4 OS=Mus musculus OX=10090 GN=Bmp4 PE=1 SV=2
17	A5HMF8	2.59e-38	145	404	0.280	0.297	A5HMF8_ANAPL Bone morphogenetic protein 4 OS=Anas platyrhynchos OX=8839 GN=BMP4 PE=2 SV=1
18	O93369	4.86e-38	144	411	0.277	0.290	O93369_DANRE Bone morphogenetic protein 2 OS=Danio rerio OX=7955 GN=BMP2b PE=2 SV=1
19	Q8UVQ2	6.63e-38	143	391	0.256	0.281	Q8UVQ2_DANRE Anti-dorsalizing morphogenetic protein OS=Danio rerio OX=7955 GN=wu:fe05b04 PE=2 SV=1
20	Q90752	5.50e-37	141	405	0.287	0.304	BMP4_CHICK Bone morphogenetic protein 4 OS=Gallus gallus OX=9031 GN=BMP4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00688 TGFb_propeptide	9.8e-15	66.4	TGF-beta propeptide
2	PF00019 TGF_beta	6.4e-26	102.6	Transforming growth factor beta like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000463051

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362299	0.999	Endoglin
2	9606.ENSP00000363708	0.999	Bone morphogenetic protein receptor type-2
3	9606.ENSP00000373574	0.999	Serine/threonine-protein kinase receptor R3
4	9606.ENSP00000340361	0.998	Activin receptor type-2B
5	9606.ENSP00000241416	0.990	Activin receptor type-2A
6	9606.ENSP00000263640	0.970	Activin receptor type-1
7	9606.ENSP00000369154	0.968	Mothers against decapentaplegic homolog 9
8	9606.ENSP00000441954	0.967	Mothers against decapentaplegic homolog 5
9	9606.ENSP00000426568	0.953	Mothers against decapentaplegic homolog 1
10	9606.ENSP00000383003	0.917	Peptidyl-prolyl cis-trans isomerase FKBP1A
11	9606.ENSP00000365042	0.900	Casein kinase II subunit beta
12	9606.ENSP00000361107	0.799	Bone morphogenetic protein receptor type-1A
13	9606.ENSP00000337014	0.711	Hemojuvelin
14	9606.ENSP00000364133	0.710	TGF-beta receptor type-1
15	9606.ENSP00000341551	0.703	Mothers against decapentaplegic homolog 4
16	9606.ENSP00000401907	0.688	Bone morphogenetic protein receptor type-1B
17	9606.ENSP00000295379	0.667	Bone morphogenetic protein 10
18	9606.ENSP00000321856	0.657	Cysteine rich with EGF like domains 1
19	9606.ENSP00000262160	0.649	Mothers against decapentaplegic homolog 2
20	9606.ENSP00000383938	0.649	Cysteine rich with EGF like domains 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.968	signaling receptor binding
GO:0098772	0.857	molecular function regulator activity
GO:0140677	0.730	molecular function activator activity
GO:0030545	0.643	signaling receptor regulator activity
GO:0030546	0.535	signaling receptor activator activity
GO:0048018	0.534	receptor ligand activity
GO:0042802	0.474	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032502	0.995	developmental process
GO:0032501	0.995	multicellular organismal process
GO:0050794	0.995	regulation of cellular process
GO:0048856	0.994	anatomical structure development
GO:0048522	0.994	positive regulation of cellular process
GO:0009966	0.990	regulation of signal transduction
GO:0009987	0.989	cellular process
GO:0051239	0.989	regulation of multicellular organismal process
GO:0050896	0.987	response to stimulus
GO:0019222	0.986	regulation of metabolic process
GO:0050793	0.984	regulation of developmental process
GO:0090092	0.980	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0060255	0.976	regulation of macromolecule metabolic process
GO:0031323	0.974	regulation of cellular metabolic process
GO:0080090	0.971	regulation of primary metabolic process
GO:0051171	0.971	regulation of nitrogen compound metabolic process
GO:0007275	0.971	multicellular organism development
GO:0042127	0.969	regulation of cell population proliferation
GO:0010604	0.969	positive regulation of macromolecule metabolic process
GO:0007154	0.967	cell communication
GO:0048519	0.964	negative regulation of biological process
GO:0007165	0.961	signal transduction
GO:0090100	0.959	positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0051094	0.957	positive regulation of developmental process
GO:0051240	0.941	positive regulation of multicellular organismal process
GO:0007166	0.941	cell surface receptor signaling pathway
GO:0008284	0.937	positive regulation of cell population proliferation
GO:0048523	0.933	negative regulation of cellular process
GO:0009653	0.930	anatomical structure morphogenesis
GO:0007178	0.926	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0072359	0.925	circulatory system development
GO:0090287	0.922	regulation of cellular response to growth factor stimulus
GO:0071704	0.913	organic substance metabolic process
GO:0051174	0.903	regulation of phosphorus metabolic process
GO:0010468	0.900	regulation of gene expression
GO:0009888	0.892	tissue development
GO:0045595	0.891	regulation of cell differentiation
GO:0030509	0.891	BMP signaling pathway
GO:0061035	0.888	regulation of cartilage development
GO:0044238	0.876	primary metabolic process
GO:0019219	0.873	regulation of nucleobase-containing compound metabolic process
GO:0044237	0.870	cellular metabolic process
GO:0051173	0.864	positive regulation of nitrogen compound metabolic process
GO:0043170	0.855	macromolecule metabolic process
GO:0031325	0.852	positive regulation of cellular metabolic process
GO:0060393	0.848	regulation of pathway-restricted SMAD protein phosphorylation
GO:0006807	0.841	nitrogen compound metabolic process
GO:0050678	0.838	regulation of epithelial cell proliferation
GO:0035295	0.836	tube development
GO:0001568	0.825	blood vessel development
GO:0048514	0.799	blood vessel morphogenesis
GO:0051093	0.785	negative regulation of developmental process
GO:0045597	0.775	positive regulation of cell differentiation
GO:0009889	0.773	regulation of biosynthetic process
GO:0030334	0.770	regulation of cell migration
GO:0051241	0.757	negative regulation of multicellular organismal process
GO:0001525	0.757	angiogenesis
GO:0001503	0.754	ossification
GO:0010556	0.749	regulation of macromolecule biosynthetic process
GO:0031326	0.749	regulation of cellular biosynthetic process
GO:0006357	0.741	regulation of transcription by RNA polymerase II
GO:0045893	0.724	positive regulation of DNA-templated transcription
GO:0010628	0.720	positive regulation of gene expression
GO:0030154	0.718	cell differentiation
GO:0061036	0.707	positive regulation of cartilage development
GO:1901564	0.701	organonitrogen compound metabolic process
GO:0010605	0.698	negative regulation of macromolecule metabolic process
GO:0051172	0.682	negative regulation of nitrogen compound metabolic process
GO:0031324	0.676	negative regulation of cellular metabolic process
GO:0048729	0.672	tissue morphogenesis
GO:0019538	0.661	protein metabolic process
GO:0060429	0.657	epithelium development
GO:0043412	0.652	macromolecule modification
GO:0050679	0.650	positive regulation of epithelial cell proliferation
GO:0006793	0.648	phosphorus metabolic process
GO:0051247	0.616	positive regulation of protein metabolic process
GO:0048513	0.607	animal organ development
GO:0031401	0.606	positive regulation of protein modification process
GO:0045944	0.592	positive regulation of transcription by RNA polymerase II
GO:0022603	0.568	regulation of anatomical structure morphogenesis
GO:0061138	0.558	morphogenesis of a branching epithelium
GO:0060562	0.536	epithelial tube morphogenesis
GO:0042592	0.510	homeostatic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.998	membrane-bounded organelle
GO:0005615	0.998	extracellular space
GO:0005622	0.929	intracellular anatomical structure
GO:0071944	0.891	cell periphery
GO:0031982	0.855	vesicle
GO:0016020	0.818	membrane
GO:0043229	0.710	intracellular organelle
GO:0043230	0.699	extracellular organelle
GO:1903561	0.689	extracellular vesicle
GO:0005737	0.688	cytoplasm
GO:0070062	0.683	extracellular exosome
GO:0043231	0.669	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]