StarFunc result for job id Q9UK41

User Input

>input (221 residues)
MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDC
VSPSEYTAACSRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKD
DKGNLNRCIADVVSLFITVMDKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTV
SQWLQTLSGMSASDELDDSQVRQMLFDLESAYNAFNRFLHA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B5DEN9	0.561	0.545	1.753E-30	228	0.982	0.952	B5DEN9.pdb.gz	VPS28_RAT Vacuolar protein sorting-associated protein 28 homolog OS=Rattus norvegicus OX=10116 GN=Vps28 PE=2 SV=1
2	AFDB:Q6PH25	0.751	0.745	5.403E-28	223	0.873	0.865	Q6PH25.pdb.gz	Q6PH25_DANRE Vacuolar protein sorting-associated protein 28 homolog OS=Danio rerio OX=7955 GN=zgc:66078 PE=1 SV=1
3	AFDB:Q9V359	0.615	0.642	1.091E-22	210	0.593	0.624	Q9V359.pdb.gz	VPS28_DROME Vacuolar protein sorting-associated protein 28 homolog OS=Drosophila melanogaster OX=7227 GN=Vps28 PE=1 SV=1
4	AFDB:Q9NA26	0.509	0.534	1.037E-17	210	0.425	0.448	Q9NA26.pdb.gz	VPS28_CAEEL Vacuolar protein sorting-associated protein 28 homolog OS=Caenorhabditis elegans OX=6239 GN=vps-28 PE=1 SV=1
5	AFDB:Q9S9T7	0.448	0.470	7.439E-16	210	0.376	0.395	Q9S9T7.pdb.gz	VP282_ARATH Vacuolar protein sorting-associated protein 28 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=VPS28-2 PE=1 SV=2
6	AFDB:O13872	0.423	0.378	1.057E-10	248	0.276	0.246	O13872.pdb.gz	VPS28_SCHPO Vacuolar protein sorting-associated protein 28 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps28 PE=3 SV=1
7	AFDB:Q59SD1	0.437	0.394	2.746E-10	248	0.276	0.246	Q59SD1.pdb.gz	Q59SD1_CANAL Vacuolar protein sorting-associated protein 28 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=VPS28 PE=3 SV=1
8	AFDB:Q02767	0.440	0.405	3.194E-10	242	0.308	0.281	Q02767.pdb.gz	VPS28_YEAST Vacuolar protein sorting-associated protein 28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS28 PE=1 SV=1
9	AFDB:C8VPT8	0.229	0.272	2.973E-2	178	0.100	0.124	C8VPT8.pdb.gz	C8VPT8_EMENI Uncharacterized protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10326 PE=4 SV=1
10	AFDB:Q24151	0.124	0.046	1.045E-1	761	0.136	0.039	Q24151.pdb.gz	STAT_DROME Signal transducer and transcription activator OS=Drosophila melanogaster OX=7227 GN=Stat92E PE=1 SV=1
11	PDB:2kmfA	0.325	0.566	3.097E-1	115	0.059	0.113	2kmfA.pdb.gz
12	PDB:5jxdA	0.248	0.281	3.787E-1	186	0.127	0.151	5jxdA.pdb.gz	The Tnfaip8-PE complex is a novel upstream effector in the anti-autophagic action of insulin
13	PDB:3zc0B	0.184	0.211	3.982E-1	191	0.122	0.141	3zc0B.pdb.gz	Structural Basis for Duplex RNA Recognition and Cleavage by Archaeoglobus Fulgidus C3Po.
14	PDB:3u8vA	0.314	0.752	4.187E-1	83	0.036	0.096	3u8vA.pdb.gz
15	PDB:7o6eA	0.158	0.193	5.953E-1	177	0.104	0.130	7o6eA.pdb.gz
16	PDB:3zqeB	0.260	0.238	6.583E-1	248	0.149	0.133	3zqeB.pdb.gz	Crystal Structure of Prgi-Sipd: Insight Into a Secretion Competent State of the Type Three Secretion System Needle Tip and its Interaction with Host Ligands
17	PDB:3hajA	0.211	0.168	7.655E-1	286	0.059	0.045	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
18	PDB:7e7qA	0.168	0.038	7.655E-1	1958	0.131	0.015	7e7qA.pdb.gz	Structural basis of substrate recognition and translocation by human ABCA4.
19	PDB:4k1nA	0.202	0.112	9.842E-1	520	0.109	0.046	4k1nA.pdb.gz
20	PDB:3euhB	0.138	0.101	1.144	321	0.118	0.081	3euhB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q548N1	7.50e-168	462	221	1.000	1.000	Q548N1_HUMAN Vacuolar protein sorting-associated protein 28 homolog OS=Homo sapiens OX=9606 GN=VPS28 PE=1 SV=1
2	Q9UK41	7.50e-168	462	221	1.000	1.000	VPS28_HUMAN Vacuolar protein sorting-associated protein 28 homolog OS=Homo sapiens OX=9606 GN=VPS28 PE=1 SV=1
3	Q9D1C8	9.06e-167	460	221	0.986	0.986	VPS28_MOUSE Vacuolar protein sorting-associated protein 28 homolog OS=Mus musculus OX=10090 GN=Vps28 PE=1 SV=1
4	B5DEN9	2.62e-163	451	228	0.982	0.952	VPS28_RAT Vacuolar protein sorting-associated protein 28 homolog OS=Rattus norvegicus OX=10116 GN=Vps28 PE=2 SV=1
5	Q6PH25	6.90e-146	407	223	0.878	0.870	Q6PH25_DANRE Vacuolar protein sorting-associated protein 28 homolog OS=Danio rerio OX=7955 GN=zgc:66078 PE=1 SV=1
6	Q9V359	5.70e-102	295	210	0.593	0.624	VPS28_DROME Vacuolar protein sorting-associated protein 28 homolog OS=Drosophila melanogaster OX=7227 GN=Vps28 PE=1 SV=1
7	Q9NA26	1.52e-61	193	210	0.425	0.448	VPS28_CAEEL Vacuolar protein sorting-associated protein 28 homolog OS=Caenorhabditis elegans OX=6239 GN=vps-28 PE=1 SV=1
8	Q9S9T7	7.78e-53	171	210	0.376	0.395	VP282_ARATH Vacuolar protein sorting-associated protein 28 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=VPS28-2 PE=1 SV=2
9	O65421	6.01e-48	158	209	0.371	0.392	VP281_ARATH Vacuolar protein sorting-associated protein 28 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=VPS28-1 PE=1 SV=1
10	Q02767	6.89e-32	118	242	0.308	0.281	VPS28_YEAST Vacuolar protein sorting-associated protein 28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS28 PE=1 SV=1
11	O13872	1.16e-26	104	248	0.299	0.266	VPS28_SCHPO Vacuolar protein sorting-associated protein 28 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps28 PE=3 SV=1
12	Q59SD1	4.45e-19	84.7	248	0.262	0.234	Q59SD1_CANAL Vacuolar protein sorting-associated protein 28 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=VPS28 PE=3 SV=1
13	P37282	2.4	31.6	542	0.154	0.063	CH60_LACLA Chaperonin GroEL OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=groEL PE=3 SV=2
14	Q9AEP7	2.4	31.6	542	0.154	0.063	CH60_LACLM Chaperonin GroEL OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=groEL PE=3 SV=1
15	O81900	4.5	30.4	207	0.054	0.058	DYT1_ARATH Transcription factor DYT1 OS=Arabidopsis thaliana OX=3702 GN=DYT1 PE=2 SV=1
16	Q69Z23	5.0	30.8	4481	0.127	0.006	DYH17_MOUSE Dynein axonemal heavy chain 17 OS=Mus musculus OX=10090 GN=Dnah17 PE=1 SV=2
17	Q9ZVD1	5.4	30.4	743	0.136	0.040	Q9ZVD1_ARATH At2g27090 OS=Arabidopsis thaliana OX=3702 GN=At2g27090 PE=1 SV=1
18	E7F8Q6	9.7	29.6	968	0.100	0.023	E7F8Q6_DANRE Angiomotin OS=Danio rerio OX=7955 GN=amot PE=3 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19443 DAHL	1.5e+02	13.5	DAHL domain
2	PF03997 VPS28	2.9e-61	218.1	VPS28 protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 27679.XP_010328151.1

Rank	PPI partner	STRING score	Description
1	27679.XP_003919942.1	0.996	Tumor susceptibility gene 101 protein isoform X1
2	27679.XP_010349701.1	0.994	Multivesicular body subunit 12B
3	27679.XP_010336221.1	0.993	Vacuolar protein-sorting-associated protein 36
4	27679.XP_010341222.1	0.993	Vacuolar protein sorting-associated protein 37B
5	27679.XP_003942791.1	0.987	Vacuolar protein-sorting-associated protein 25
6	27679.XP_003944488.1	0.986	Charged multivesicular body protein 2a
7	27679.XP_003919943.2	0.982	Ubiquitin-conjugating enzyme E2 variant 3 isoform X1
8	27679.XP_003942317.1	0.979	Multivesicular body subunit 12A
9	27679.XP_010340817.1	0.978	Charged multivesicular body protein 6
10	27679.XP_003931286.1	0.977	Vacuolar-sorting protein SNF8
11	27679.XP_010330041.1	0.975	Ubiquitin-associated protein 1 isoform X1
12	27679.XP_003935607.1	0.967	Vacuolar protein sorting-associated protein 37A
13	27679.XP_010342941.1	0.967	Vacuolar protein sorting-associated protein 37D
14	27679.XP_010340609.1	0.956	Involved in intracellular signal transduction mediated by cytokines and growth factors. When associated with STAM, it suppresses DNA signaling upon stimulation by IL-2 and GM-CSF. Could be a direct effector of PI3-kinase in vesicular pathway via early endosomes and may regulate trafficking to early and late endosomes by recruiting clathrin. May concentrate ubiquitinated receptors within clathrin- coated regions. Involved in down-regulation of receptor tyrosine kinase via multivesicular body (MVBs) when complexed with STAM (ESCRT-0 complex). The ESCRT-0 complex binds ubiquitin and acts [...]
15	27679.XP_010333620.1	0.947	Vacuolar protein sorting-associated protein 37C
16	27679.XP_003932100.1	0.944	Charged multivesicular body protein 4b
17	27679.XP_003928364.1	0.932	Charged multivesicular body protein 2b
18	27679.XP_010330842.1	0.929	Charged multivesicular body protein 1a
19	27679.XP_003924909.1	0.918	Charged multivesicular body protein 1b
20	27679.XP_010348736.1	0.917	Charged multivesicular body protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.988	organic substance metabolic process
GO:0044237	0.988	cellular metabolic process
GO:0044238	0.987	primary metabolic process
GO:0007032	0.986	endosome organization
GO:0006508	0.984	proteolysis
GO:0030163	0.981	protein catabolic process
GO:0006914	0.979	autophagy
GO:0043162	0.972	ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
GO:0016236	0.970	macroautophagy
GO:0050789	0.961	regulation of biological process
GO:0046755	0.951	viral budding
GO:0050794	0.908	regulation of cellular process
GO:0019222	0.852	regulation of metabolic process
GO:0060255	0.820	regulation of macromolecule metabolic process
GO:0044085	0.774	cellular component biogenesis
GO:0051179	0.759	localization
GO:0031399	0.758	regulation of protein modification process
GO:0051234	0.745	establishment of localization
GO:0006810	0.739	transport
GO:0048519	0.735	negative regulation of biological process
GO:1903320	0.721	regulation of protein modification by small protein conjugation or removal
GO:0022607	0.712	cellular component assembly
GO:0016192	0.648	vesicle-mediated transport
GO:0048518	0.642	positive regulation of biological process
GO:0051641	0.605	cellular localization
GO:0032879	0.573	regulation of localization
GO:0051649	0.560	establishment of localization in cell
GO:0046907	0.529	intracellular transport
GO:0031400	0.524	negative regulation of protein modification process
GO:0016197	0.515	endosomal transport
GO:0070925	0.496	organelle assembly
GO:0071985	0.462	multivesicular body sorting pathway
GO:0048522	0.412	positive regulation of cellular process
GO:1903321	0.382	negative regulation of protein modification by small protein conjugation or removal
GO:0033036	0.376	macromolecule localization
GO:0045184	0.370	establishment of protein localization
GO:0051050	0.350	positive regulation of transport
GO:0015031	0.330	protein transport
GO:0009894	0.326	regulation of catabolic process
GO:0036257	0.320	multivesicular body organization
GO:0032509	0.300	endosome transport via multivesicular body sorting pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005575	1.000	cellular_component
GO:0005829	0.994	cytosol
GO:0005886	0.988	plasma membrane
GO:0031090	0.988	organelle membrane
GO:0005576	0.985	extracellular region
GO:0036452	0.985	ESCRT complex
GO:0010008	0.977	endosome membrane
GO:0070062	0.963	extracellular exosome
GO:0098796	0.944	membrane protein complex
GO:0005634	0.845	nucleus
GO:0000813	0.826	ESCRT I complex
GO:0031981	0.410	nuclear lumen
GO:0005769	0.373	early endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]