StarFunc result for job id Q9UK45

User Input

>input (103 residues)
MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDD
QYKLTEDTRQLGLVVCRGTSVVLICPQDGMEAIPNPFIQQQDA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9CQQ8	0.947	0.947	2.682E-18	103	0.971	0.971	Q9CQQ8.pdb.gz	LSM7_MOUSE U6 snRNA-associated Sm-like protein LSm7 OS=Mus musculus OX=10090 GN=Lsm7 PE=1 SV=1
2	AFDB:Q9VJI7	0.854	0.803	1.588E-13	110	0.728	0.682	Q9VJI7.pdb.gz	Q9VJI7_DROME GEO08441p1 OS=Drosophila melanogaster OX=7227 GN=LSm7 PE=1 SV=1
3	AFDB:Q23543	0.880	0.872	2.644E-13	104	0.553	0.548	Q23543.pdb.gz	Q23543_CAEEL LSM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=lsm-7 PE=1 SV=1
4	AFDB:Q9SI54	0.900	0.935	1.291E-12	99	0.505	0.525	Q9SI54.pdb.gz	LSM7_ARATH Sm-like protein LSM7 OS=Arabidopsis thaliana OX=3702 GN=LSM7 PE=1 SV=1
5	PDB:3jcr7	0.717	0.924	6.766E-12	79	0.767	1.000	3jcr7.pdb.gz
6	AFDB:O74499	0.861	0.788	1.561E-11	113	0.563	0.513	O74499.pdb.gz	LSM7_SCHPO U6 snRNA-associated Sm-like protein LSm7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lsm7 PE=1 SV=1
7	PDB:6ppqG	0.788	0.949	2.951E-11	85	0.515	0.624	6ppqG.pdb.gz	Molecular basis for the distinct cellular functions of the Lsm1-7 and Lsm2-8 complexes.
8	PDB:6ah0y	0.612	0.962	2.313E-9	65	0.621	0.985	6ah0y.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
9	AFDB:P53905	0.750	0.677	3.590E-9	115	0.427	0.383	P53905.pdb.gz	LSM7_YEAST U6 snRNA-associated Sm-like protein LSm7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LSM7 PE=1 SV=2
10	PDB:4c92G	0.682	0.924	2.642E-8	75	0.369	0.507	4c92G.pdb.gz
11	AFDB:Q4Q9J1	0.686	0.768	1.074E-7	91	0.398	0.451	Q4Q9J1.pdb.gz	Q4Q9J1_LEIMA Putative Lsm7p protein OS=Leishmania major OX=5664 GN=LMJF_26_0005 PE=3 SV=1
12	AFDB:A0A1D8PTG5	0.576	0.616	8.735E-7	96	0.272	0.292	A0A1D8PTG5.pdb.gz	A0A1D8PTG5_CANAL U6 snRNA-associated Sm-like protein LSm3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SMX4 PE=3 SV=1
13	PDB:3jb9J	0.617	0.859	8.853E-7	73	0.262	0.370	3jb9J.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
14	AFDB:Q9VXE0	0.619	0.832	1.159E-6	76	0.291	0.395	Q9VXE0.pdb.gz	RUXG_DROME Probable small nuclear ribonucleoprotein G OS=Drosophila melanogaster OX=7227 GN=SNRPG PE=1 SV=1
15	AFDB:D6XGY7	0.664	0.738	1.299E-6	92	0.320	0.359	D6XGY7.pdb.gz	D6XGY7_TRYB2 U6 snRNA-associated Sm-like protein LSm7p OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.45E22.290 PE=3 SV=1
16	PDB:4m75F	0.595	0.806	1.316E-6	75	0.369	0.507	4m75F.pdb.gz
17	PDB:4emkC	0.561	0.953	1.393E-6	60	0.330	0.567	4emkC.pdb.gz
18	PDB:3bw1A	0.623	0.734	2.319E-6	86	0.262	0.314	3bw1A.pdb.gz
19	PDB:5o9zp	0.566	0.782	3.447E-6	73	0.223	0.315	5o9zp.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
20	PDB:6ppnH	0.606	0.662	4.086E-6	94	0.204	0.223	6ppnH.pdb.gz	Molecular basis for the distinct cellular functions of the Lsm1-7 and Lsm2-8 complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UK45	1.37e-71	209	103	1.000	1.000	LSM7_HUMAN U6 snRNA-associated Sm-like protein LSm7 OS=Homo sapiens OX=9606 GN=LSM7 PE=1 SV=1
2	Q9CQQ8	2.82e-70	206	103	0.971	0.971	LSM7_MOUSE U6 snRNA-associated Sm-like protein LSm7 OS=Mus musculus OX=10090 GN=Lsm7 PE=1 SV=1
3	Q9VJI7	1.18e-50	157	110	0.728	0.682	Q9VJI7_DROME GEO08441p1 OS=Drosophila melanogaster OX=7227 GN=LSm7 PE=1 SV=1
4	Q23543	6.90e-40	129	104	0.553	0.548	Q23543_CAEEL LSM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=lsm-7 PE=1 SV=1
5	Q9SI54	1.66e-36	121	99	0.505	0.525	LSM7_ARATH Sm-like protein LSM7 OS=Arabidopsis thaliana OX=3702 GN=LSM7 PE=1 SV=1
6	O74499	1.83e-34	116	113	0.563	0.513	LSM7_SCHPO U6 snRNA-associated Sm-like protein LSm7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lsm7 PE=1 SV=1
7	P53905	4.74e-24	90.1	115	0.427	0.383	LSM7_YEAST U6 snRNA-associated Sm-like protein LSm7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LSM7 PE=1 SV=2
8	Q9N4G9	3.97e-15	66.2	77	0.301	0.403	RUXG_CAEEL Probable small nuclear ribonucleoprotein G OS=Caenorhabditis elegans OX=6239 GN=snr-7 PE=3 SV=1
9	Q9VXE0	4.39e-14	63.5	76	0.282	0.382	RUXG_DROME Probable small nuclear ribonucleoprotein G OS=Drosophila melanogaster OX=7227 GN=SNRPG PE=1 SV=1
10	Q4Q9J1	4.61e-14	63.9	91	0.408	0.462	Q4Q9J1_LEIMA Putative Lsm7p protein OS=Leishmania major OX=5664 GN=LMJF_26_0005 PE=3 SV=1
11	B5DEP7	4.57e-12	58.5	76	0.252	0.342	B5DEP7_RAT Small nuclear ribonucleoprotein G OS=Rattus norvegicus OX=10116 GN=LOC687679 PE=2 SV=1
12	P62308	4.57e-12	58.5	76	0.252	0.342	RUXG_HUMAN Small nuclear ribonucleoprotein G OS=Homo sapiens OX=9606 GN=SNRPG PE=1 SV=1
13	O82221	7.50e-11	55.5	80	0.262	0.338	RUXG_ARATH Probable small nuclear ribonucleoprotein G OS=Arabidopsis thaliana OX=3702 GN=At2g23930 PE=3 SV=1
14	Q9CAX7	7.56e-11	55.5	79	0.272	0.354	Q9CAX7_ARATH Small nuclear ribonucleoprotein G OS=Arabidopsis thaliana OX=3702 GN=F24K9.17 PE=1 SV=1
15	D6XGY7	1.11e-09	52.8	92	0.330	0.370	D6XGY7_TRYB2 U6 snRNA-associated Sm-like protein LSm7p OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.45E22.290 PE=3 SV=1
16	Q6QA15	1.11e-09	52.8	92	0.330	0.370	Q6QA15_9TRYP Lsm7p OS=Trypanosoma brucei OX=5691 GN=Lsm7 PE=3 SV=1
17	O74966	1.23e-09	52.4	77	0.272	0.364	RUXG_SCHPO Small nuclear ribonucleoprotein G OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=smg1 PE=1 SV=1
18	P40204	4.66e-09	50.8	77	0.291	0.390	RUXG_YEAST Small nuclear ribonucleoprotein G OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SMX2 PE=1 SV=1
19	C9JVQ0	5.30e-09	51.2	96	0.194	0.208	C9JVQ0_HUMAN Small nuclear ribonucleoprotein G OS=Homo sapiens OX=9606 GN=SNRPG PE=1 SV=1
20	P40089	3.79e-08	48.9	93	0.184	0.204	LSM5_YEAST U6 snRNA-associated Sm-like protein LSm5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LSM5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01423 LSM	8.1e-18	75.2	LSM domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 118797.XP_007460498.1

Rank	PPI partner	STRING score	Description
1	118797.XP_007447456.1	0.999	LSM5 homolog, U6 small nuclear RNA and mRNA degradation associated
2	118797.XP_007453411.1	0.999	Small nuclear ribonucleoprotein F
3	118797.XP_007459607.1	0.999	LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated
4	118797.XP_007461110.1	0.999	LSM4 homolog, U6 small nuclear RNA and mRNA degradation associated
5	118797.XP_007466972.1	0.999	Plays role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA
6	118797.XP_007472061.1	0.999	LSM6 homolog, U6 small nuclear RNA and mRNA degradation associated
7	118797.XP_007448381.1	0.998	LSM1 homolog, mRNA degradation associated
8	118797.XP_007449212.1	0.998	LSM3 homolog, U6 small nuclear RNA and mRNA degradation associated
9	118797.XP_007451094.1	0.998	Small nuclear ribonucleoprotein Sm D3
10	118797.XP_007452443.1	0.998	Binds specifically to the 3'-terminal U-tract of U6 snRNA.
11	118797.XP_007450383.1	0.995	Belongs to the SF3B5 family.
12	118797.XP_007453466.1	0.995	Plays role in pre-mRNA splicing as core component of the SMN- Sm complex that mediates spliceosomal snRNP assembly and as component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. Is also a component of the minor U12 spliceosome. As part of the U7 snRNP it is involved in histone 3'-end processing.
13	118797.XP_007453711.1	0.995	Plays role in pre-mRNA splicing as core component of the SMN- Sm complex that mediates spliceosomal snRNP assembly and as component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. Is also a component of the minor U12 spliceosome.
14	118797.XP_007458576.1	0.995	Plays role in pre-mRNA splicing as core component of the SMN- Sm complex that mediates spliceosomal snRNP assembly and as component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. Is also a component of the minor U12 spliceosome.
15	118797.XP_007462031.1	0.995	Squamous cell carcinoma antigen recognized by T-cells 1
16	118797.XP_007461542.1	0.992	Zinc finger matrin-type 2
17	118797.XP_007448672.1	0.991	Small nuclear ribonucleoprotein Sm D1
18	118797.XP_007455276.1	0.991	Plays role in pre-mRNA splicing as core component of the SMN- Sm complex that mediates spliceosomal snRNP assembly and as component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. Is also a component of the minor U12 spliceosome. As part of the U7 snRNP it is involved in histone 3'-end processing. May indirectly play a role in hair development.
19	118797.XP_007470712.1	0.991	Small nuclear ribonucleoprotein E
20	118797.XP_007449814.1	0.990	pre-mRNA processing factor 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	0.796	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008380	0.995	RNA splicing
GO:0006397	0.988	mRNA processing
GO:0000377	0.988	RNA splicing, via transesterification reactions with bulged adenosine as nucleophile
GO:0000398	0.977	mRNA splicing, via spliceosome
GO:0050789	0.310	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1990904	1.000	ribonucleoprotein complex
GO:0140513	1.000	nuclear protein-containing complex
GO:0005654	0.999	nucleoplasm
GO:0005737	0.996	cytoplasm
GO:0005829	0.992	cytosol
GO:0120114	0.988	Sm-like protein family complex
GO:0071011	0.976	precatalytic spliceosome
GO:0005684	0.942	U2-type spliceosomal complex
GO:0030532	0.938	small nuclear ribonucleoprotein complex
GO:0071005	0.929	U2-type precatalytic spliceosome
GO:0097525	0.912	spliceosomal snRNP complex
GO:0097526	0.802	spliceosomal tri-snRNP complex
GO:0046540	0.784	U4/U6 x U5 tri-snRNP complex
GO:1902494	0.782	catalytic complex
GO:0071013	0.759	catalytic step 2 spliceosome
GO:0120115	0.458	Lsm2-8 complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]