StarFunc result for job id Q9UK61

User Input

>input (1670 residues)
MATAVETEACQPTDASWESGGGGDDEMKQALPELESSQQNGGGGGLNIAEPSGGAGREEN
AGAEAAQSLSHEQPQDSSEAGAAALPRGPEEPERPVRRSFQIPRKSREKKALFQPLTPGS
REFEDVVNILHSSYLEPTSVTNFNYRRACLVHNELLEKEFTEKRRELKFDGRLDKELSES
YAFLMVDRYQVQTICEKGLHVGQSKITILGSPSMGVYLSRYADLLQANPLDTGAMGDVVI
FKIMKGKIKSIYDPMGVKSLESMLNKSALDPTPKHECHVSKNANRITSLLAYRAYELTQY
YFYEYGFDELRRRPRHVCPYAVVSFTYKDDIQTPKFVPSSRSNSFNTDRNIDKYNYTLWK
GQLLNKGKLLCYISLRSATRAFLPIKLPEKLDVETVMSIDHLKQKIPPALFYKETYLGPN
EVLKNGMYCSLYEVVEKTRIGSNMESLLQKLDREKLVLVKPLGDRGYLFLLSPYQMVPPY
EYQTAKSRVLHALFLFQEPRSIVTSQKGSTNAAPQERHESMPDVLKIAQFLQFSLIQCRK
EFKNISAINFHSVVEKYVSEFFKRGFGSGKREFIMFPYDSRLDDKKFLYSAPRNKSHIDT
CLHAYIFRPEVYQLPICKLKELFEENRKLQQFSPLSDYEGQEEEMNGTKMKFGKRNNSRG
EAIISGKQRSSHSLDYDKDRVKELINLIQCRKKSVGGDSDTEDMRSKTVLKRKLEDLPEN
MRKLAKTSNLSENCHLYEESPQPIGSLGHDADLRRQQQDTCNSGIADIHRLFNWLSETLA
NARHSDASLTDTVNKALGLSTDDAYEELRQKHEYELNSTPDKKDYEQPTCAKVENAQFKG
TQSLLLEVDATSKYSVAISTSEVGTDHKLHLKEDPNLISVNNFEDCSLCPSVPIEHGFRR
QQSKSNNVEETEIHWKLIPITGGNARSPEDQLGKHGEKQTPGMKSPEEQLVCVPPQEAFP
NDPRVINRQRSSDYQFPSSPFTDTLKGTTEDDVLTGQVEEQCVPAAEAEPPAVSETTERT
VLGEYNLFSRKIEEILKQKNVSYVSTVSTPIFSTQEKMKRLSEFIYSKTSKAGVQEFVDG
LHEKLNTIIIKASAKGGNLPPVSPNDSGAKIASNPLERHVIPVSSSDFNNKHLLEPLCSD
PLKDTNSDEQHSTSALTEVEMNQPQHATELMVTSDHIVPGDMAREPVEETTKSPSDVNIS
AQPALSNFISQLEPEVFNSLVKIMKDVQKNTVKFYIHEEEESVLCKEIKEYLIKLGNTEC
HPEQFLERRSKLDKLLIIIQNEDIAGFIHKIPGLVTLKKLPCVSFAGVDSLDDVKNHTYN
ELFVSGGFIVSDESILNPEVVTVENLKNFLTFLEELSTPEGKWQWKVHCKFQKKLKELGR
LNAKALSLLTLLNVYQKKHLVEILSYHNCDSQTRNAPELDCLIRLQAQNIQQRHIVFLTE
KNIKMLSSYTDNGIVVATAEDFMQNFKNLVGYHNSITEENLPQLGANENLESQSALLEND
EKDEEDMSLDSGDEISHIEVCSNFHSEIWEKETKGSRGTDQKKNTQIELQSSPDVQNSLL
EDKTYLDSEERTSIDIVCSEGENSNSTEQDSYSNFQVYHSQLNMSHQFSHFNVLTHQTFL
GTPYALSSSQSQENENYFLSAYTESLDRDKSPPPLSWGKSDSSRPYSQEK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q69ZR9	0.294	0.302	0.000	1610	0.789	0.818	Q69ZR9.pdb.gz	TASOR_MOUSE Protein TASOR OS=Mus musculus OX=10090 GN=Tasor PE=1 SV=2
2	AFDB:Q9UK61	1.000	1.000	0.000	1670	1.000	1.000	Q9UK61.pdb.gz	TASOR_HUMAN Protein TASOR OS=Homo sapiens OX=9606 GN=TASOR PE=1 SV=3
3	AFDB:Q5VWN6	0.147	0.103	6.806E-22	2430	0.149	0.102	Q5VWN6.pdb.gz	TASO2_HUMAN Protein TASOR 2 OS=Homo sapiens OX=9606 GN=TASOR2 PE=1 SV=1
4	PDB:6x0lP	0.091	0.279	1.443E-5	474	0.018	0.063	6x0lP.pdb.gz	Bridging of DNA breaks activates PARP2-HPF1 to modify chromatin.
5	AFDB:P35689	0.054	0.067	9.830E-4	1170	0.073	0.104	P35689.pdb.gz	ERCC5_MOUSE DNA excision repair protein ERCC-5 OS=Mus musculus OX=10090 GN=Ercc5 PE=1 SV=4
6	AFDB:Q96M83	0.041	0.045	2.357E-3	1385	0.101	0.121	Q96M83.pdb.gz	CCDC7_HUMAN Coiled-coil domain-containing protein 7 OS=Homo sapiens OX=9606 GN=CCDC7 PE=1 SV=3
7	AFDB:E2QD16	0.033	0.034	3.855E-3	1570	0.129	0.138	E2QD16.pdb.gz	E2QD16_DROME Non-specific lethal 1, isoform M OS=Drosophila melanogaster OX=7227 GN=nsl1 PE=1 SV=1
8	PDB:6sn1B	0.057	0.167	4.486E-3	503	0.020	0.066	6sn1B.pdb.gz
9	AFDB:P07663	0.051	0.058	6.304E-3	1224	0.092	0.125	P07663.pdb.gz	PER_DROME Period circadian protein OS=Drosophila melanogaster OX=7227 GN=per PE=1 SV=2
10	AFDB:Q4AB30	0.035	0.041	6.658E-3	1044	0.096	0.154	Q4AB30.pdb.gz	Q4AB30_DROME Wiskott-Aldrich syndrome protein family member OS=Drosophila melanogaster OX=7227 GN=gukh PE=1 SV=1
11	AFDB:Q86AT9	0.055	0.053	9.762E-3	1736	0.098	0.094	Q86AT9.pdb.gz	DHKI_DICDI Hybrid signal transduction histidine kinase I OS=Dictyostelium discoideum OX=44689 GN=dhkI-1 PE=3 SV=1
12	AFDB:Q5TGY3	0.037	0.037	1.089E-2	1603	0.124	0.129	Q5TGY3.pdb.gz	AHDC1_HUMAN Transcription factor Gibbin OS=Homo sapiens OX=9606 GN=AHDC1 PE=1 SV=1
13	PDB:7mq8SL	0.057	0.361	1.267E-2	192	0.012	0.104	7mq8SL.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:6yxyBA	0.066	0.131	1.666E-2	769	0.014	0.031	6yxyBA.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
15	PDB:7nfcC	0.060	0.158	2.312E-2	477	0.020	0.069	7nfcC.pdb.gz	Cryo-EM of NHEJ supercomplexes provides insights into DNA repair.
16	PDB:7d5s5K	0.055	0.398	3.209E-2	175	0.012	0.114	7d5s5K.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
17	PDB:5y58A	0.057	0.153	3.994E-2	548	0.017	0.051	5y58A.pdb.gz	Structural Insights into Yeast Telomerase Recruitment to Telomeres
18	PDB:6joxA	0.055	0.203	4.970E-2	245	0.018	0.122	6joxA.pdb.gz
19	PDB:3l8eA	0.064	0.387	5.544E-2	185	0.011	0.103	3l8eA.pdb.gz	Structural Determinants of Substrate Recognition in the HAD Superfamily Member d-glycero-d-manno-Heptose-1,7-bisphosphate Phosphatase (GmhB) .
20	PDB:5cb0A	0.074	0.252	8.128E-2	290	0.015	0.086	5cb0A.pdb.gz	Crystal structure and functional implications of the tandem-type universal stress protein UspE from Escherichia coli.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087X0F1	0.0	2060	1035	0.609	0.983	A0A087X0F1_HUMAN Transcription activation suppressor OS=Homo sapiens OX=9606 GN=TASOR PE=1 SV=1
2	Q69ZR9	0.0	2575	1610	0.788	0.817	TASOR_MOUSE Protein TASOR OS=Mus musculus OX=10090 GN=Tasor PE=1 SV=2
3	Q9UK61	0.0	3466	1670	1.000	1.000	TASOR_HUMAN Protein TASOR OS=Homo sapiens OX=9606 GN=TASOR PE=1 SV=3
4	A0A2R8YH03	9.26e-47	188	2645	0.085	0.054	A0A2R8YH03_HUMAN Transcription activation suppressor family member 2 OS=Homo sapiens OX=9606 GN=TASOR2 PE=1 SV=1
5	Q5VWN6	1.65e-45	184	2430	0.060	0.041	TASO2_HUMAN Protein TASOR 2 OS=Homo sapiens OX=9606 GN=TASOR2 PE=1 SV=1
6	Q9ULL8	0.68	37.4	1493	0.017	0.019	SHRM4_HUMAN Protein Shroom4 OS=Homo sapiens OX=9606 GN=SHROOM4 PE=1 SV=3
7	P35735	4.5	33.9	353	0.009	0.042	SFK1_YEAST Protein SFK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SFK1 PE=1 SV=1
8	Q96PC5	6.7	33.9	1412	0.030	0.035	MIA2_HUMAN Melanoma inhibitory activity protein 2 OS=Homo sapiens OX=9606 GN=MIA2 PE=1 SV=4
9	E9Q634	9.8	33.5	1107	0.012	0.018	MYO1E_MOUSE Unconventional myosin-Ie OS=Mus musculus OX=10090 GN=Myo1e PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12509 DUF3715	2.1e-50	182.0	Protein of unknown function (DUF3715)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008970320.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003833045.1	0.826	M-phase phosphoprotein 8
2	9597.XP_003825783.1	0.717	Periphilin 1
3	9597.XP_008951614.1	0.697	Belongs to the peptidase C19 family.
4	9597.XP_003819953.1	0.663	Prostate and testis expressed 2
5	9597.XP_003808481.1	0.628	Down-regulator of transcription 1
6	9597.XP_003815966.1	0.628	VPS26, retromer complex component A
7	9597.XP_003825972.1	0.579	R3H domain containing like
8	9597.XP_003817358.1	0.544	Regulation of nuclear pre-mRNA domain containing 2
9	9597.XP_003833137.1	0.536	Multiple EGF like domains 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	1.000	chromatin binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.971	cellular process
GO:0050794	0.963	regulation of cellular process
GO:0019222	0.930	regulation of metabolic process
GO:0060255	0.902	regulation of macromolecule metabolic process
GO:0048518	0.874	positive regulation of biological process
GO:0048519	0.872	negative regulation of biological process
GO:0051171	0.868	regulation of nitrogen compound metabolic process
GO:0080090	0.864	regulation of primary metabolic process
GO:0010468	0.862	regulation of gene expression
GO:0051172	0.861	negative regulation of nitrogen compound metabolic process
GO:0031324	0.860	negative regulation of cellular metabolic process
GO:0010605	0.858	negative regulation of macromolecule metabolic process
GO:0048522	0.835	positive regulation of cellular process
GO:0044087	0.682	regulation of cellular component biogenesis
GO:0010629	0.651	negative regulation of gene expression
GO:1902679	0.650	negative regulation of RNA biosynthetic process
GO:0051128	0.605	regulation of cellular component organization
GO:0071840	0.586	cellular component organization or biogenesis
GO:0051179	0.559	localization
GO:0016043	0.557	cellular component organization
GO:0032501	0.502	multicellular organismal process
GO:0031445	0.457	regulation of heterochromatin formation
GO:2001252	0.457	positive regulation of chromosome organization
GO:0045814	0.452	negative regulation of gene expression, epigenetic
GO:0044089	0.393	positive regulation of cellular component biogenesis
GO:0008104	0.321	protein localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043232	0.991	intracellular non-membrane-bounded organelle
GO:0005694	0.982	chromosome
GO:0000785	0.906	chromatin
GO:0000792	0.902	heterochromatin
GO:0005829	0.711	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]