StarFunc result for job id Q9UK73

User Input

>input (627 residues)
MEGLAGYVYKAASEGKVLTLAALLLNRSESDIRYLLGYVSQQGGQRSTPLIIAARNGHAK
VVRLLLEHYRVQTQQTGTVRFDGYVIDGATALWCAAGAGHFEVVKLLVSHGANVNHTTVT
NSTPLRAACFDGRLDIVKYLVENNANISIANKYDNTCLMIAAYKGHTDVVRYLLEQRADP
NAKAHCGATALHFAAEAGHIDIVKELIKWRAAIVVNGHGMTPLKVAAESCKADVVELLLS
HADCDRRSRIEALELLGASFANDRENYDIIKTYHYLYLAMLERFQDGDNILEKEVLPPIH
AYGNRTECRNPQELESIRQDRDALHMEGLIVRERILGADNIDVSHPIIYRGAVYADNMEF
EQCIKLWLHALHLRQKGNRNTHKDLLRFAQVFSQMIHLNETVKAPDIECVLRCSVLEIEQ
SMNRVKNISDADVHNAMDNYECNLYTFLYLVCISTKTQCSEEDQCKINKQIYNLIHLDPR
TREGFTLLHLAVNSNTPVDDFHTNDVCSFPNALVTKLLLDCGAEVNAVDNEGNSALHIIV
QYNRPISDFLTLHSIIISLVEAGAHTDMTNKQNKTPLDKSTTGVSEILLKTQMKMSLKCL
AARAVRANDINYQDQIPRTLEEFVGFH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UK73	1.000	1.000	6.834E-85	627	1.000	1.000	Q9UK73.pdb.gz	FEM1B_HUMAN Protein fem-1 homolog B OS=Homo sapiens OX=9606 GN=FEM1B PE=1 SV=1
2	AFDB:Q96JP0	0.863	0.876	6.038E-41	617	0.405	0.412	Q96JP0.pdb.gz	FEM1C_HUMAN Protein fem-1 homolog C OS=Homo sapiens OX=9606 GN=FEM1C PE=1 SV=1
3	AFDB:Q9BSK4	0.876	0.823	1.328E-39	669	0.386	0.362	Q9BSK4.pdb.gz	FEM1A_HUMAN Protein fem-1 homolog A OS=Homo sapiens OX=9606 GN=FEM1A PE=1 SV=1
4	AFDB:P17221	0.786	0.754	2.837E-30	656	0.311	0.297	P17221.pdb.gz	FEM1_CAEEL Sex-determining protein fem-1 OS=Caenorhabditis elegans OX=6239 GN=fem-1 PE=1 SV=1
5	AFDB:P97582	0.340	0.264	3.994E-18	843	0.220	0.164	P97582.pdb.gz	P97582_RAT Ankyrin (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
6	AFDB:Q3UES3	0.206	0.113	5.526E-17	1166	0.233	0.125	Q3UES3.pdb.gz	TNKS2_MOUSE Poly [ADP-ribose] polymerase tankyrase-2 OS=Mus musculus OX=10090 GN=Tnks2 PE=2 SV=2
7	AFDB:A0A0R4IYN3	0.208	0.104	5.743E-17	1274	0.230	0.113	A0A0R4IYN3.pdb.gz	A0A0R4IYN3_DANRE Poly [ADP-ribose] polymerase OS=Danio rerio OX=7955 GN=si:ch211-155m12.3 PE=3 SV=1
8	AFDB:O95271	0.205	0.099	1.344E-16	1327	0.220	0.104	O95271.pdb.gz	TNKS1_HUMAN Poly [ADP-ribose] polymerase tankyrase-1 OS=Homo sapiens OX=9606 GN=TNKS PE=1 SV=2
9	AFDB:Q9ULJ7	0.383	0.177	1.083E-15	1429	0.223	0.098	Q9ULJ7.pdb.gz	ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens OX=9606 GN=ANKRD50 PE=1 SV=4
10	AFDB:Q9VBP3	0.197	0.107	1.169E-15	1181	0.226	0.120	Q9VBP3.pdb.gz	TNKS_DROME Poly [ADP-ribose] polymerase tankyrase OS=Drosophila melanogaster OX=7227 GN=Tnks PE=1 SV=1
11	PDB:8cs9A	0.210	0.170	1.229E-15	796	0.206	0.162	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
12	PDB:5vkqA	0.362	0.165	1.329E-10	1499	0.188	0.079	5vkqA.pdb.gz
13	PDB:4oauC	0.360	0.328	4.648E-9	692	0.120	0.108	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
14	PDB:2dvwA	0.319	0.844	4.831E-9	229	0.110	0.301	2dvwA.pdb.gz
15	PDB:6pqpA	0.259	0.263	1.897E-7	615	0.155	0.158	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
16	PDB:1wg0A	0.319	0.784	3.953E-7	243	0.089	0.230	1wg0A.pdb.gz
17	PDB:6v9hC	0.306	0.676	7.058E-7	270	0.091	0.211	6v9hC.pdb.gz
18	PDB:6v9xA	0.248	0.269	1.260E-6	571	0.174	0.191	6v9xA.pdb.gz
19	PDB:6mwqA	0.243	0.307	3.310E-6	493	0.136	0.172	6mwqA.pdb.gz
20	PDB:6mhvA	0.246	0.251	3.441E-6	613	0.169	0.173	6mhvA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UK73	0.0	1301	627	1.000	1.000	FEM1B_HUMAN Protein fem-1 homolog B OS=Homo sapiens OX=9606 GN=FEM1B PE=1 SV=1
2	Q9Z2G0	0.0	1293	627	0.990	0.990	FEM1B_MOUSE Protein fem-1 homolog B OS=Mus musculus OX=10090 GN=Fem1b PE=1 SV=1
3	Q96JP0	2.40e-143	431	617	0.408	0.415	FEM1C_HUMAN Protein fem-1 homolog C OS=Homo sapiens OX=9606 GN=FEM1C PE=1 SV=1
4	Q9Z2G1	8.64e-124	382	654	0.392	0.376	FM1AA_MOUSE Protein fem-1 homolog A-A OS=Mus musculus OX=10090 GN=Fem1aa PE=1 SV=1
5	Q9BSK4	1.89e-121	377	669	0.392	0.368	FEM1A_HUMAN Protein fem-1 homolog A OS=Homo sapiens OX=9606 GN=FEM1A PE=1 SV=1
6	P17221	1.39e-64	226	656	0.230	0.220	FEM1_CAEEL Sex-determining protein fem-1 OS=Caenorhabditis elegans OX=6239 GN=fem-1 PE=1 SV=1
7	P16157	1.72e-26	118	1881	0.142	0.047	ANK1_HUMAN Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3
8	G5E8K5	2.46e-25	114	1961	0.115	0.037	ANK3_MOUSE Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1
9	Q12955	3.42e-25	114	4377	0.115	0.016	ANK3_HUMAN Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3
10	A0A5F9ZH34	4.94e-25	113	1689	0.129	0.048	A0A5F9ZH34_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
11	O70511	5.36e-25	113	2622	0.113	0.027	ANK3_RAT Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3
12	Q8C8R3	2.71e-24	111	3898	0.131	0.021	ANK2_MOUSE Ankyrin-2 OS=Mus musculus OX=10090 GN=Ank2 PE=1 SV=2
13	X2JCM1	2.85e-24	111	11634	0.120	0.006	X2JCM1_DROME Ankyrin 2, isoform AA OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
14	M9MRX4	2.87e-24	111	13559	0.120	0.006	M9MRX4_DROME Ankyrin 2, isoform U OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
15	A0A5F9ZI46	3.03e-24	111	3882	0.131	0.021	A0A5F9ZI46_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
16	A0A5F9ZGX3	3.04e-24	111	3972	0.131	0.021	A0A5F9ZGX3_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
17	D6RHE1	3.04e-24	111	3961	0.131	0.021	D6RHE1_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=2
18	F1LM42	3.04e-24	111	4021	0.131	0.020	F1LM42_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=4
19	A0A5F9ZHF7	3.05e-24	111	3862	0.131	0.021	A0A5F9ZHF7_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
20	A0A5F9ZHD2	3.06e-24	111	3936	0.131	0.021	A0A5F9ZHD2_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16193 AAA_assoc_2	6.5e+02	12.0	AAA C-terminal domain
2	PF00023 Ank	2.1e-36	134.0	Ankyrin repeat
3	PF12796 Ank_2	3.5e-45	163.8	Ankyrin repeats (3 copies)
4	PF13606 Ank_3	1.8e-33	121.6	Ankyrin repeat
5	PF13637 Ank_4	1.7e-37	138.5	Ankyrin repeats (many copies)
6	PF13857 Ank_5	1.5e-31	119.3	Ankyrin repeats (many copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000016007

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000022045	0.847	Uncharacterized protein
2	61853.ENSNLEP00000023382	0.847	Uncharacterized protein
3	61853.ENSNLEP00000023974	0.847	Uncharacterized protein
4	61853.ENSNLEP00000001913	0.816	Transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C)
5	61853.ENSNLEP00000000304	0.752	Protein phosphatase, Mg2+/Mn2+ dependent, 1F
6	61853.ENSNLEP00000011517	0.752	Elongin B
7	61853.ENSNLEP00000022143	0.752	annotation not available
8	61853.ENSNLEP00000023467	0.746	Protein phosphatase, Mg2+/Mn2+ dependent, 1E
9	61853.ENSNLEP00000013856	0.723	COP9 signalosome subunit 6
10	61853.ENSNLEP00000003409	0.710	Receptor for activated C kinase 1
11	61853.ENSNLEP00000010353	0.700	Ring finger protein 152
12	61853.ENSNLEP00000017238	0.686	Spermatogenesis associated 17
13	61853.ENSNLEP00000002934	0.638	Small glutamine-rich tetratricopeptide repeat (TPR)-containing, alpha
14	61853.ENSNLEP00000018730	0.628	Ring-box 1, E3 ubiquitin protein ligase
15	61853.ENSNLEP00000013089	0.609	COP9 signalosome subunit 8
16	61853.ENSNLEP00000011027	0.603	Cadherin 19
17	61853.ENSNLEP00000008767	0.601	DCN1-like protein
18	61853.ENSNLEP00000003775	0.593	COMM domain containing 2
19	61853.ENSNLEP00000016090	0.593	COMM domain containing 4
20	61853.ENSNLEP00000021798	0.593	COMM domain containing 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030674	0.768	protein-macromolecule adaptor activity
GO:1990756	0.761	ubiquitin ligase-substrate adaptor activity
GO:0005102	0.652	signaling receptor binding
GO:0005123	0.457	death receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.992	regulation of biological process
GO:0009987	0.987	cellular process
GO:0050794	0.984	regulation of cellular process
GO:0044238	0.983	primary metabolic process
GO:0006807	0.979	nitrogen compound metabolic process
GO:0043170	0.975	macromolecule metabolic process
GO:0019538	0.965	protein metabolic process
GO:0044237	0.962	cellular metabolic process
GO:0048583	0.942	regulation of response to stimulus
GO:0010646	0.862	regulation of cell communication
GO:0051603	0.852	proteolysis involved in protein catabolic process
GO:0023051	0.847	regulation of signaling
GO:0032501	0.820	multicellular organismal process
GO:0009966	0.801	regulation of signal transduction
GO:0019222	0.768	regulation of metabolic process
GO:0043632	0.766	modification-dependent macromolecule catabolic process
GO:0010498	0.735	proteasomal protein catabolic process
GO:0009653	0.718	anatomical structure morphogenesis
GO:0065009	0.712	regulation of molecular function
GO:0006511	0.680	ubiquitin-dependent protein catabolic process
GO:0007275	0.676	multicellular organism development
GO:0060255	0.621	regulation of macromolecule metabolic process
GO:0050790	0.618	regulation of catalytic activity
GO:0036211	0.607	protein modification process
GO:0080134	0.594	regulation of response to stress
GO:0042981	0.584	regulation of apoptotic process
GO:0051338	0.574	regulation of transferase activity
GO:1902531	0.566	regulation of intracellular signal transduction
GO:0048518	0.552	positive regulation of biological process
GO:0051171	0.547	regulation of nitrogen compound metabolic process
GO:0080090	0.544	regulation of primary metabolic process
GO:0048519	0.536	negative regulation of biological process
GO:0080135	0.528	regulation of cellular response to stress
GO:2001233	0.527	regulation of apoptotic signaling pathway
GO:0009888	0.506	tissue development
GO:0048523	0.500	negative regulation of cellular process
GO:0043161	0.473	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0070647	0.462	protein modification by small protein conjugation or removal
GO:0000003	0.458	reproduction
GO:0031323	0.418	regulation of cellular metabolic process
GO:0001655	0.408	urogenital system development
GO:0048522	0.396	positive regulation of cellular process
GO:0050896	0.394	response to stimulus
GO:2001236	0.347	regulation of extrinsic apoptotic signaling pathway
GO:2001020	0.330	regulation of response to DNA damage stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0031981	0.995	nuclear lumen
GO:0005654	0.994	nucleoplasm
GO:0032991	0.990	protein-containing complex
GO:0005829	0.975	cytosol
GO:0000151	0.876	ubiquitin ligase complex
GO:0031461	0.851	cullin-RING ubiquitin ligase complex
GO:0031462	0.507	Cul2-RING ubiquitin ligase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]