StarFunc result for job id Q9UK80

User Input

>input (565 residues)
MPQASEHRLGRTREPPVNIQPRVGSKLPFAPRARSKERRNPASGPNPMLRPLPPRPGLPD
ERLKKLELGRGRTSGPRPRGPLRADHGVPLPGSPPPTVALPLPSRTNLARSKSVSSGDLR
PMGIALGGHRGTGELGAALSRLALRPEPPTLRRSTSLRRLGGFPGPPTLFSIRTEPPASH
GSFHMISARSSEPFYSDDKMAHHTLLLGSGHVGLRNLGNTCFLNAVLQCLSSTRPLRDFC
LRRDFRQEVPGGGRAQELTEAFADVIGALWHPDSCEAVNPTRFRAVFQKYVPSFSGYSQQ
DAQEFLKLLMERLHLEINRRGRRAPPILANGPVPSPPRRGGALLEEPELSDDDRANLMWK
RYLEREDSKIVDLFVGQLKSCLKCQACGYRSTTFEVFCDLSLPIPKKGFAGGKVSLRDCF
NLFTKEEELESENAPVCDRCRQKTRSTKKLTVQRFPRILVLHLNRFSASRGSIKKSSVGV
DFPLQRLSLGDFASDKAGSPVYQLYALCNHSGSVHYGHYTALCRCQTGWHVYNDSRVSPV
SENQVASSEGYVLFYQLMQEPPRCL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9QZL6	0.752	0.751	3.305E-97	566	0.966	0.965	Q9QZL6.pdb.gz	UBP21_MOUSE Ubiquitin carboxyl-terminal hydrolase 21 OS=Mus musculus OX=10090 GN=Usp21 PE=1 SV=1
2	AFDB:X2JLM6	0.527	0.527	1.146E-39	565	0.301	0.301	X2JLM6.pdb.gz	X2JLM6_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp2 PE=3 SV=1
3	AFDB:F4I642	0.507	0.314	9.839E-30	928	0.237	0.144	F4I642.pdb.gz	F4I642_ARATH Ubiquitin-specific protease 15 OS=Arabidopsis thaliana OX=3702 GN=UBP15 PE=1 SV=1
4	PDB:5cvnB	0.477	0.824	1.633E-28	321	0.165	0.290	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
5	PDB:3mhsA	0.474	0.582	1.943E-28	455	0.166	0.207	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
6	PDB:5k16B	0.456	0.757	2.668E-26	328	0.170	0.293	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
7	PDB:7ay1D	0.448	0.717	1.725E-24	341	0.159	0.264	7ay1D.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
8	PDB:4fjcE	0.430	0.550	4.112E-24	434	0.158	0.205	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
9	PDB:8a9kD	0.411	0.790	7.338E-24	285	0.140	0.277	8a9kD.pdb.gz	Cryo-EM reveals a mechanism of USP1 inhibition through a cryptic binding site.
10	PDB:4wa6D	0.436	0.583	3.713E-23	415	0.156	0.212	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
11	PDB:7yxxA	0.446	0.152	9.378E-23	1754	0.140	0.045	7yxxA.pdb.gz
12	PDB:3ihpB	0.452	0.379	8.972E-22	681	0.149	0.123	3ihpB.pdb.gz	Covalent Ubiquitin-Usp5 Complex
13	AFDB:Q9W0L7	0.517	0.203	1.384E-21	1517	0.204	0.076	Q9W0L7.pdb.gz	Q9W0L7_DROME LD28815p OS=Drosophila melanogaster OX=7227 GN=Usp10 PE=1 SV=2
14	PDB:5k1bA	0.392	0.800	1.601E-21	264	0.163	0.348	5k1bA.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
15	AFDB:Q86T82	0.480	0.285	5.886E-21	979	0.218	0.126	Q86T82.pdb.gz	UBP37_HUMAN Ubiquitin carboxyl-terminal hydrolase 37 OS=Homo sapiens OX=9606 GN=USP37 PE=1 SV=2
16	AFDB:Q9LK83	0.069	0.046	1.230	1156	0.152	0.074	Q9LK83.pdb.gz	Q9LK83_ARATH Portal protein OS=Arabidopsis thaliana OX=3702 GN=RASD1 PE=1 SV=1
17	AFDB:P97499	0.077	0.034	1.463	2629	0.097	0.021	P97499.pdb.gz	TEP1_MOUSE Telomerase protein component 1 OS=Mus musculus OX=10090 GN=Tep1 PE=1 SV=1
18	AFDB:Q385F2	0.082	0.044	1.955	1231	0.104	0.048	Q385F2.pdb.gz	Q385F2_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4040 PE=3 SV=1
19	AFDB:F4HYG2	0.086	0.047	2.071	1235	0.087	0.040	F4HYG2.pdb.gz	IRE3_ARATH Probable serine/threonine protein kinase IRE3 OS=Arabidopsis thaliana OX=3702 GN=IRE3 PE=2 SV=1
20	AFDB:A0A140VJR0	0.068	0.053	2.611	809	0.090	0.063	A0A140VJR0.pdb.gz	A0A140VJR0_HUMAN Phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE4D PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2GUX4	0.0	1107	565	0.966	0.966	UBP21_RAT Ubiquitin carboxyl-terminal hydrolase 21 OS=Rattus norvegicus OX=10116 GN=Usp21 PE=2 SV=1
2	Q9QZL6	0.0	1101	566	0.966	0.965	UBP21_MOUSE Ubiquitin carboxyl-terminal hydrolase 21 OS=Mus musculus OX=10090 GN=Usp21 PE=1 SV=1
3	Q9UK80	0.0	1145	565	1.000	1.000	UBP21_HUMAN Ubiquitin carboxyl-terminal hydrolase 21 OS=Homo sapiens OX=9606 GN=USP21 PE=1 SV=1
4	E9QFQ5	2.42e-128	383	404	0.336	0.470	E9QFQ5_DANRE Ubiquitin carboxyl-terminal hydrolase OS=Danio rerio OX=7955 GN=usp21 PE=3 SV=2
5	O57429	7.70e-115	347	357	0.304	0.482	UBP2_CHICK Ubiquitin carboxyl-terminal hydrolase 2 OS=Gallus gallus OX=9031 GN=USP2 PE=2 SV=1
6	Q5U349	8.96e-107	335	618	0.315	0.288	UBP2_RAT Ubiquitin carboxyl-terminal hydrolase 2 OS=Rattus norvegicus OX=10116 GN=Usp2 PE=1 SV=1
7	O75604	1.34e-106	334	605	0.313	0.293	UBP2_HUMAN Ubiquitin carboxyl-terminal hydrolase 2 OS=Homo sapiens OX=9606 GN=USP2 PE=1 SV=2
8	O88623	1.34e-105	332	619	0.312	0.284	UBP2_MOUSE Ubiquitin carboxyl-terminal hydrolase 2 OS=Mus musculus OX=10090 GN=Usp2 PE=1 SV=3
9	X2JLM6	4.61e-76	253	565	0.242	0.242	X2JLM6_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp2 PE=3 SV=1
10	Q8IQ27	4.04e-74	256	938	0.242	0.146	UBP2_DROME Ubiquitin carboxyl-terminal hydrolase Usp2 OS=Drosophila melanogaster OX=7227 GN=Usp2 PE=1 SV=1
11	X2JG37	4.51e-74	256	950	0.242	0.144	X2JG37_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp2 PE=3 SV=1
12	Q8IQ26	3.47e-69	227	315	0.225	0.403	Q8IQ26_DROME Ubiquitin specific protease 2, isoform K OS=Drosophila melanogaster OX=7227 GN=Usp2 PE=4 SV=2
13	P40818	1.46e-56	207	1118	0.221	0.112	UBP8_HUMAN Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens OX=9606 GN=USP8 PE=1 SV=1
14	H1UUC2	5.30e-56	194	367	0.209	0.322	H1UUC2_DROME FI18309p1 OS=Drosophila melanogaster OX=7227 GN=Usp8 PE=2 SV=1
15	D3ZN39	5.70e-56	205	1081	0.219	0.115	D3ZN39_RAT ubiquitinyl hydrolase 1 OS=Rattus norvegicus OX=10116 GN=Usp8 PE=1 SV=2
16	Q80U87	8.07e-56	205	1080	0.221	0.116	UBP8_MOUSE Ubiquitin carboxyl-terminal hydrolase 8 OS=Mus musculus OX=10090 GN=Usp8 PE=1 SV=2
17	Q9VDD8	3.33e-53	196	896	0.209	0.132	Q9VDD8_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp8 PE=1 SV=2
18	Q8MQX4	2.75e-52	194	896	0.207	0.131	Q8MQX4_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp8 PE=2 SV=1
19	Q6P8X6	4.23e-51	182	390	0.202	0.292	UBP50_MOUSE Putative ubiquitin carboxyl-terminal hydrolase 50 OS=Mus musculus OX=10090 GN=Usp50 PE=2 SV=1
20	P32571	2.80e-48	182	926	0.225	0.137	UBP4_YEAST Ubiquitin carboxyl-terminal hydrolase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DOA4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15499 Peptidase_C98	52	14.8	Ubiquitin-specific peptidase-like, SUMO isopeptidase
2	PF00443 UCH	8.4e-64	227.3	Ubiquitin carboxyl-terminal hydrolase
3	PF13423 UCH_1	2e-10	52.4	Ubiquitin carboxyl-terminal hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356981

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000441543	0.998	Polyubiquitin-C
2	9606.ENSP00000304697	0.990	Polyubiquitin-B
3	9606.ENSP00000272317	0.987	Ubiquitin-40S ribosomal protein S27a
4	9606.ENSP00000388107	0.982	Ubiquitin-60S ribosomal protein L40
5	9606.ENSP00000334808	0.932	Ubiquitin carboxyl-terminal hydrolase 16
6	9606.ENSP00000259808	0.927	Receptor-interacting serine/threonine-protein kinase 1
7	9606.ENSP00000348632	0.920	RanBP-type and C3HC4-type zinc finger-containing protein 1
8	9606.ENSP00000315112	0.914	E3 ubiquitin-protein ligase RNF31
9	9606.ENSP00000368215	0.911	TGF-beta-activated kinase 1 and MAP3K7-binding protein 3
10	9606.ENSP00000162749	0.907	Tumor necrosis factor receptor superfamily member 1A
11	9606.ENSP00000381698	0.907	Sharpin
12	9606.ENSP00000247668	0.906	TNF receptor-associated factor 2
13	9606.ENSP00000358335	0.906	Mitogen-activated protein kinase kinase kinase 7
14	9606.ENSP00000359424	0.906	Inhibitor of nuclear factor kappa-B kinase subunit alpha
15	9606.ENSP00000360242	0.906	E3 ubiquitin-protein ligase XIAP
16	9606.ENSP00000483825	0.906	NF-kappa-B essential modulator
17	9606.ENSP00000216160	0.905	TGF-beta-activated kinase 1 and MAP3K7-binding protein 1
18	9606.ENSP00000430684	0.905	Inhibitor of nuclear factor kappa-B kinase subunit beta
19	9606.ENSP00000341268	0.904	Tumor necrosis factor receptor type 1-associated DEATH domain protein
20	9606.ENSP00000356426	0.904	TGF-beta-activated kinase 1 and MAP3K7-binding protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004843	1.000	cysteine-type deubiquitinase activity
GO:0005515	0.987	protein binding
GO:0003712	0.976	transcription coregulator activity
GO:0003713	0.966	transcription coactivator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006508	0.996	proteolysis
GO:0036211	0.996	protein modification process
GO:0070646	0.990	protein modification by small protein removal
GO:0016579	0.970	protein deubiquitination
GO:0009987	0.878	cellular process
GO:0050794	0.871	regulation of cellular process
GO:0019222	0.792	regulation of metabolic process
GO:0060255	0.779	regulation of macromolecule metabolic process
GO:0048518	0.728	positive regulation of biological process
GO:0051171	0.715	regulation of nitrogen compound metabolic process
GO:0080090	0.714	regulation of primary metabolic process
GO:0031323	0.665	regulation of cellular metabolic process
GO:0048522	0.584	positive regulation of cellular process
GO:0019219	0.554	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.525	regulation of macromolecule biosynthetic process
GO:0031326	0.525	regulation of cellular biosynthetic process
GO:0071840	0.443	cellular component organization or biogenesis
GO:0010468	0.431	regulation of gene expression
GO:0051252	0.406	regulation of RNA metabolic process
GO:0016043	0.403	cellular component organization
GO:0006355	0.372	regulation of DNA-templated transcription
GO:0009893	0.367	positive regulation of metabolic process
GO:0010604	0.362	positive regulation of macromolecule metabolic process
GO:0048519	0.356	negative regulation of biological process
GO:0051173	0.355	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005829	0.989	cytosol
GO:0005654	0.988	nucleoplasm
GO:0016020	0.923	membrane
GO:0071944	0.856	cell periphery
GO:0005886	0.839	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	1.000	ubiquitinyl hydrolase 1.

[back to server]