StarFunc result for job id Q9UKA1

User Input

>input (691 residues)
MAPFPEEVDVFTAPHWRMKQLVGLYCDKLSKTNFSNNNDFRALLQSLYATFKEFKMHEQI
ENEYIIGLLQQRSQTIYNVHSDNKLSEMLSLFEKGLKNVKNEYEQLNYAKQLKERLEAFT
RDFLPHMKEEEEVFQPMLMEYFTYEELKDIKKKVIAQHCSQKDTAELLRGLSLWNHAEER
QKFFKYSVDEKSDKEAEVSEHSTGITHLPPEVMLSIFSYLNPQELCRCSQVSMKWSQLTK
TGSLWKHLYPVHWARGDWYSGPATELDTEPDDEWVKNRKDESRAFHEWDEDADIDESEES
AEESIAISIAQMEKRLLHGLIHNVLPYVGTSVKTLVLAYSSAVSSKMVRQILELCPNLEH
LDLTQTDISDSAFDSWSWLGCCQSLRHLDLSGCEKITDVALEKISRALGILTSHQSGFLK
TSTSKITSTAWKNKDITMQSTKQYACLHDLTNKGIGEEIDNEHPWTKPVSSENFTSPYVW
MLDAEDLADIEDTVEWRHRNVESLCVMETASNFSCSTSGCFSKDIVGLRTSVCWQQHCAS
PAFAYCGHSFCCTGTALRTMSSLPESSAMCRKAARTRLPRGKDLIYFGSEKSDQETGRVL
LFLSLSGCYQITDHGLRVLTLGGGLPYLEHLNLSGCLTITGAGLQDLVSACPSLNDEYFY
YCDNINGPHADTASGCQNLQCGFRACCRSGE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UKA1	1.000	1.000	1.755E-95	691	1.000	1.000	Q9UKA1.pdb.gz	FBXL5_HUMAN F-box/LRR-repeat protein 5 OS=Homo sapiens OX=9606 GN=FBXL5 PE=1 SV=2
2	PDB:6o60C	0.247	0.418	1.534E-6	389	0.100	0.177	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.
3	PDB:7b5mT	0.116	0.236	7.545E-3	325	0.072	0.154	7b5mT.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
4	PDB:7sa1B	0.109	0.119	1.750E-2	624	0.062	0.069	7sa1B.pdb.gz
5	PDB:4i6jB	0.122	0.189	4.844E-2	394	0.049	0.086	4i6jB.pdb.gz
6	AFDB:Q7TPV4	0.085	0.061	5.138E-2	1344	0.155	0.080	Q7TPV4.pdb.gz	MBB1A_MOUSE Myb-binding protein 1A OS=Mus musculus OX=10090 GN=Mybbp1a PE=1 SV=2
7	PDB:2p1nB	0.129	0.152	9.004E-2	571	0.054	0.065	2p1nB.pdb.gz	Mechanism of auxin perception by the TIR1 ubiquitin ligase
8	PDB:5hywA	0.102	0.119	1.283E-1	580	0.058	0.069	5hywA.pdb.gz
9	PDB:7pzcA	0.122	0.085	1.532E-1	1010	0.032	0.022	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
10	AFDB:Q8ILP3	0.082	0.065	2.119E-1	969	0.114	0.082	Q8ILP3.pdb.gz	P113_PLAF7 Surface protein P113 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=P113 PE=1 SV=1
11	PDB:1a4yA	0.104	0.147	2.723E-1	460	0.035	0.052	1a4yA.pdb.gz
12	AFDB:Q9ULE0	0.073	0.055	2.888E-1	1092	0.114	0.072	Q9ULE0.pdb.gz	WWC3_HUMAN Protein WWC3 OS=Homo sapiens OX=9606 GN=WWC3 PE=1 SV=3
13	PDB:7pmkL	0.117	0.157	3.251E-1	475	0.033	0.048	7pmkL.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
14	PDB:3oglB	0.099	0.119	3.881E-1	568	0.025	0.030	3oglB.pdb.gz	Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor.
15	AFDB:D3ZEY0	0.070	0.039	9.546E-1	1530	0.094	0.042	D3ZEY0.pdb.gz	CC141_RAT Coiled-coil domain-containing protein 141 OS=Rattus norvegicus OX=10116 GN=Ccdc141 PE=1 SV=2
16	AFDB:Q6ZP82	0.058	0.038	1.191	1450	0.097	0.046	Q6ZP82.pdb.gz	CC141_HUMAN Coiled-coil domain-containing protein 141 OS=Homo sapiens OX=9606 GN=CCDC141 PE=1 SV=3
17	AFDB:Q6DRL4	0.102	0.049	2.118	1824	0.110	0.042	Q6DRL4.pdb.gz	TICRR_DANRE Treslin OS=Danio rerio OX=7955 GN=ticrr PE=2 SV=1
18	AFDB:A0A0R4IF44	0.075	0.035	2.314	1792	0.119	0.046	A0A0R4IF44.pdb.gz
19	AFDB:P19334	0.062	0.040	2.643	1275	0.107	0.058	P19334.pdb.gz	TRP_DROME Transient receptor potential protein OS=Drosophila melanogaster OX=7227 GN=trp PE=1 SV=3
20	AFDB:P33981	0.058	0.051	2.762	857	0.090	0.072	P33981.pdb.gz	TTK_HUMAN Dual specificity protein kinase TTK OS=Homo sapiens OX=9606 GN=TTK PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8C2S5	0.0	1344	690	0.936	0.938	FBXL5_MOUSE F-box/LRR-repeat protein 5 OS=Mus musculus OX=10090 GN=Fbxl5 PE=2 SV=2
2	Q9UKA1	0.0	1446	691	1.000	1.000	FBXL5_HUMAN F-box/LRR-repeat protein 5 OS=Homo sapiens OX=9606 GN=FBXL5 PE=1 SV=2
3	A0A0B4KEK4	8.31e-09	60.8	455	0.078	0.119	A0A0B4KEK4_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9003 PE=4 SV=1
4	Q5BI22	8.44e-09	60.8	437	0.078	0.124	Q5BI22_DROME LD12638p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9003 PE=2 SV=1
5	A8DYA5	9.33e-09	60.5	426	0.078	0.127	A8DYA5_DROME LP16447p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9003 PE=2 SV=1
6	Q8BH16	9.92e-09	60.5	423	0.080	0.130	FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus OX=10090 GN=Fbxl2 PE=1 SV=1
7	A1Z8M8	1.04e-08	60.5	464	0.078	0.116	A1Z8M8_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=FBXL2 PE=4 SV=1
8	Q9UKC9	1.35e-08	60.1	423	0.078	0.128	FBXL2_HUMAN F-box/LRR-repeat protein 2 OS=Homo sapiens OX=9606 GN=FBXL2 PE=1 SV=3
9	A0A0B4KEU4	1.37e-08	60.1	497	0.078	0.109	A0A0B4KEU4_DROME Uncharacterized protein, isoform F OS=Drosophila melanogaster OX=7227 GN=FBXL2 PE=4 SV=1
10	A8DYA6	1.46e-08	60.5	651	0.084	0.089	A8DYA6_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9003 PE=4 SV=1
11	Q96IG2	2.58e-08	59.3	436	0.077	0.122	FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens OX=9606 GN=FBXL20 PE=1 SV=2
12	Q9CZV8	4.13e-08	58.5	436	0.077	0.122	FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus OX=10090 GN=Fbxl20 PE=1 SV=3
13	P34284	9.35e-08	57.4	466	0.078	0.116	FBXL_CAEEL F-box/LRR-repeat protein fbxl-1 OS=Caenorhabditis elegans OX=6239 GN=fbxl-1 PE=2 SV=3
14	Q5BJ29	9.92e-07	54.3	491	0.068	0.096	FBXL7_MOUSE F-box/LRR-repeat protein 7 OS=Mus musculus OX=10090 GN=Fbxl7 PE=1 SV=1
15	Q9UJT9	2.30e-06	53.1	491	0.068	0.096	FBXL7_HUMAN F-box/LRR-repeat protein 7 OS=Homo sapiens OX=9606 GN=FBXL7 PE=1 SV=1
16	Q9UKT5	3.95e-05	48.9	387	0.042	0.075	FBX4_HUMAN F-box only protein 4 OS=Homo sapiens OX=9606 GN=FBXO4 PE=1 SV=2
17	Q8CHQ0	4.33e-05	48.9	385	0.043	0.078	FBX4_MOUSE F-box only protein 4 OS=Mus musculus OX=10090 GN=Fbxo4 PE=1 SV=2
18	Q86XK2	2.24e-04	47.0	927	0.032	0.024	FBX11_HUMAN F-box only protein 11 OS=Homo sapiens OX=9606 GN=FBXO11 PE=1 SV=3
19	Q7TPD1	2.25e-04	47.0	930	0.032	0.024	FBX11_MOUSE F-box only protein 11 OS=Mus musculus OX=10090 GN=Fbxo11 PE=1 SV=3
20	Q9VAK7	2.43e-04	46.6	515	0.030	0.041	Q9VAK7_DROME F-box involved in polyQ pathogenesis, isoform A OS=Drosophila melanogaster OX=7227 GN=FipoQ PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00646 F-box	5e-05	34.3	F-box domain
2	PF12937 F-box-like	2.1e-11	54.9	F-box-like
3	PF19729 FBXL18_LRR	1.7e+02	12.0	F-box/LRR-repeat protein 18, LRR
4	PF01814 Hemerythrin	1.6e-05	36.9	Hemerythrin HHE cation binding domain
5	PF00560 LRR_1	0.49	21.9	Leucine Rich Repeat
6	PF12799 LRR_4	6.5e-06	37.6	Leucine Rich repeats (2 copies)
7	PF13516 LRR_6	1.4e-07	42.1	Leucine Rich repeat
8	PF13855 LRR_8	2.4	19.3	Leucine rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000344866

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231487	0.999	S-phase kinase-associated protein 1
2	9606.ENSP00000258886	0.999	Iron-responsive element-binding protein 2
3	9606.ENSP00000326804	0.999	Cullin-1
4	9606.ENSP00000309477	0.914	Cytoplasmic aconitate hydratase
5	9606.ENSP00000387471	0.864	Mitotic spindle-associated MMXD complex subunit MIP18
6	9606.ENSP00000216225	0.850	E3 ubiquitin-protein ligase RBX1
7	9606.ENSP00000412698	0.833	MMS19 nucleotide excision repair protein homolog
8	9606.ENSP00000418287	0.825	Probable cytosolic iron-sulfur protein assembly protein CIAO1
9	9606.ENSP00000344855	0.801	F-box/LRR-repeat protein 14
10	9606.ENSP00000261609	0.780	E3 ubiquitin-protein ligase HERC2
11	9606.ENSP00000244050	0.692	Zinc finger protein SNAI1
12	9606.ENSP00000405068	0.678	Nucleolar protein 14
13	9606.ENSP00000310686	0.650	F-box/WD repeat-containing protein 8
14	9606.ENSP00000359829	0.643	Ubiquitin carboxyl-terminal hydrolase 33
15	9606.ENSP00000371201	0.623	Putative methyltransferase NSUN7
16	9606.ENSP00000250495	0.620	NEDD8
17	9606.ENSP00000361646	0.617	Zinc finger MYND-type containing 12
18	9606.ENSP00000384048	0.613	PAX-interacting protein 1
19	9606.ENSP00000313034	0.609	F-box/WD repeat-containing protein 5
20	9606.ENSP00000258091	0.600	T-complex protein 1 subunit eta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005506	1.000	iron ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0009987	0.993	cellular process
GO:0030163	0.987	protein catabolic process
GO:0048878	0.968	chemical homeostasis
GO:0044237	0.961	cellular metabolic process
GO:0070647	0.949	protein modification by small protein conjugation or removal
GO:0098771	0.945	inorganic ion homeostasis
GO:0055080	0.945	monoatomic cation homeostasis
GO:0032446	0.942	protein modification by small protein conjugation
GO:0051603	0.939	proteolysis involved in protein catabolic process
GO:0044265	0.937	cellular macromolecule catabolic process
GO:0006511	0.929	ubiquitin-dependent protein catabolic process
GO:0016567	0.926	protein ubiquitination
GO:0065007	0.914	biological regulation
GO:0055072	0.904	iron ion homeostasis
GO:0050789	0.901	regulation of biological process
GO:0043161	0.894	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0031146	0.854	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
GO:0019222	0.599	regulation of metabolic process
GO:0050794	0.585	regulation of cellular process
GO:0048518	0.524	positive regulation of biological process
GO:0051171	0.487	regulation of nitrogen compound metabolic process
GO:0080090	0.482	regulation of primary metabolic process
GO:0060255	0.482	regulation of macromolecule metabolic process
GO:0009893	0.450	positive regulation of metabolic process
GO:0051173	0.420	positive regulation of nitrogen compound metabolic process
GO:0010604	0.416	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0019005	0.997	SCF ubiquitin ligase complex
GO:0048471	0.983	perinuclear region of cytoplasm
GO:0043231	0.950	intracellular membrane-bounded organelle
GO:0031981	0.935	nuclear lumen
GO:0005654	0.931	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]