StarFunc result for job id Q9UKA4

User Input

>input (1901 residues)
MATFRNNHMKTKASVRKSFSEDVFQSVKSLLQSQKELCSVTAEDCLQQDEHANLTEVTFL
GFNEETDAAHIQDLAAVSLELPDILNSLHFCSLNENEIICMKNINKPLDISSDPLNQSHP
SGMLCVMRVSPTSPRLRIDFIFSLLSKYATGIRYTLDTFLHQKHQLETTDEDDDDTNQSV
SSIEDDFVTAFEHLEEEETSKPYNDGMNITVLRSQCDAASQTVTGHHLETHDLKILISSG
QQKSLAKPSTSSVNVLGHKELPSVKTSVTTSISEPWTQRSFYRSSNASDKDSDLQKTFFS
SSPAYSSESECSSPSPVIFLDEEGYQKSLKAKLELPKIPVMKDDIEDSDSEVSEFFDSFD
QFDELEQTLETCLFNKDPVIGKSSQRKGHKHGKSCMNPQKFKFDRPALPANVRKPTPRKP
ESPYGNLCDAPDSPRPVKASREDSGLFSPIRSSAFSPLGGCTPAECFCQTDIGGDRIHEN
HDSVYYTYEDYAKSISCEVLGSVLRTHHTNTLSNINSIKHGENKTVTFKHGNLDQKNKSK
NKSLMIKDSIQKFAADLVEKSFGSAFKDLQKGVSSCTNALYHLAIKLTSSVLQMAFDELR
RQRAFSLKERAISGLANFLVSEALSNALKDLQYVKKQIFTNTVARFAADLAEELVFEGIM
EVCQFSYPQTPASPQCGSFDFEDKVVKLYAKDLSESVIQEAFIELSQVDVTFTTKAAVSV
STDNIKYVSAESVVPSTQAVTFSPSFHNQAIMVTKPVQEYKKEYTVQQALFCTSGIVTSI
PVPLAGSALLPYHISSTACQAKAHLSSDDSNSNGDSAQVHIATKNREEKAACLRNICLPS
EHNPGNQNDFKPTNDDIEMQSSSKLPNDPAIISNFSAAVVHTIVNETLESMTSLEVTKMV
DERTDYLTKSLKEKTPPFSHCDQAVLQCSEASSNKDMFADRLSKSIIKHSIDKSKSVIPN
IDKNAVYKESLPVSGEESQLTPEKSPKFPDSQNQLTHCSLSAAKDCVPECKVSMVHGSSL
ETLPSCPAVTGQKSDLKESAKDQPLKKHNLNSTSLEALSFGQENPFPHSHTFSSTALTCV
DGLHVEDKQKVRDRNVIPDTPPSTPLVPSRASSEWDIKKLTKKLKGELAKEFAPATPPST
PHNSSVGSLSENEQNTIEKEEFMLKLMRSLSEEVESSESGELPEVDVKSEHSGKKVQFAE
ALATHILSLATEMAASHLDNKIIQEPKVKNPCLNVQSQRSVSPTFLNPSDENLKTLCNFA
GDLAAEVITEAEKIAKVRNCMLFKQKKNSCYADGDEDYKVEEKLDIEAVVHPREVDPFIL
SLPPSSCMSGLMYKYPSCESVTDEYAGHLIQILKQEGGNSELIMDQYANRLAYRSVKSGL
QEAAKTTKVQCNSRMFPVPSSQVKTNKELLMFSNKEHHQEADKKRQSKRNEGYFCKNQTC
ERTLDPYRNEVSQLYSFSTSLVHSITKDAKEELTASLVGLPKSLTDSCLFEKSGYEEDNE
CHVTPELPKSLQPSSQNHRFYHSTGSLNGYGCGDNVVQAVEQYAKKVVDDTLELTLGSTV
FRVSETTKSADRVTYAEKLSPLTGQACRYCDLKELHNCTGNSSQHFFRQGSLASSKPASN
PKFSSRYQKSRIFHLSVPQIHVNLDKKAVLAEKIVAEAIEKAERELSSTSLAADSGIGQE
GASFAESLATETMTAAVTNVGHAVSSSKEIEDFQSTESVSSQQMNLSIGDDSTGSWSNLS
FEDEHQDESSSFHHLSESNGNSSSWSSLGLEGDLYEDNLSFPTSDSDGPDDKDEEHEDEV
EGLGQDGKTLLITNIDMEPCTVDPQLRIILQWLIASEAEVAELYFHDSANKEFMLLSKQL
QEKGWKVGDLLQAVLQYYEVMEKASSEERCKSLFDWLLENA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9Q777	0.207	0.208	0.000	1894	0.741	0.743	E9Q777.pdb.gz	E9Q777_MOUSE A kinase (PRKA) anchor protein 11 OS=Mus musculus OX=10090 GN=Akap11 PE=1 SV=2
2	AFDB:Q9UKA4	1.000	1.000	0.000	1901	1.000	1.000	Q9UKA4.pdb.gz	AKA11_HUMAN A-kinase anchor protein 11 OS=Homo sapiens OX=9606 GN=AKAP11 PE=1 SV=1
3	AFDB:Q2M3C7	0.133	0.147	1.420E-25	1700	0.176	0.197	Q2M3C7.pdb.gz	SPKAP_HUMAN A-kinase anchor protein SPHKAP OS=Homo sapiens OX=9606 GN=SPHKAP PE=1 SV=1
4	AFDB:Q6NSW3	0.135	0.151	8.209E-25	1687	0.168	0.189	Q6NSW3.pdb.gz	SPKAP_MOUSE A-kinase anchor protein SPHKAP OS=Mus musculus OX=10090 GN=Sphkap PE=1 SV=2
5	AFDB:B7Z043	0.048	0.050	8.069E-4	1788	0.125	0.133	B7Z043.pdb.gz	B7Z043_DROME Myocardin-related transcription factor, isoform H OS=Drosophila melanogaster OX=7227 GN=Mrtf PE=4 SV=3
6	AFDB:Q8INR6	0.037	0.038	9.107E-4	1848	0.111	0.114	Q8INR6.pdb.gz	DOT1L_DROME Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Drosophila melanogaster OX=7227 GN=gpp PE=1 SV=2
7	AFDB:F8VQG7	0.039	0.044	9.675E-4	1678	0.129	0.147	F8VQG7.pdb.gz	F8VQG7_MOUSE NEDD4 binding protein 2 OS=Mus musculus OX=10090 GN=N4bp2 PE=1 SV=1
8	AFDB:Q80U93	0.043	0.040	1.882E-3	2085	0.116	0.106	Q80U93.pdb.gz	NU214_MOUSE Nuclear pore complex protein Nup214 OS=Mus musculus OX=10090 GN=Nup214 PE=1 SV=2
9	AFDB:Q57ZN6	0.039	0.046	2.124E-3	1558	0.108	0.132	Q57ZN6.pdb.gz	Q57ZN6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27C5.80 PE=4 SV=1
10	AFDB:Q9GRZ3	0.026	0.030	2.124E-3	1641	0.092	0.107	Q9GRZ3.pdb.gz	DPY21_CAEEL Lysine-specific demethylase 9 OS=Caenorhabditis elegans OX=6239 GN=dpy-21 PE=1 SV=1
11	PDB:5ntdG	0.043	0.123	8.005E-1	520	0.008	0.031	5ntdG.pdb.gz	Structural Characterization of Acidic M17 Leucine Aminopeptidases from the TriTryps and Evaluation of Their Role in Nutrient Starvation inTrypanosoma brucei.
12	PDB:7tjjI	0.019	0.077	1.984	380	0.006	0.032	7tjjI.pdb.gz	A mechanism of origin licensing control through autoinhibition of S. cerevisiae ORC·DNA·Cdc6.
13	PDB:6y4zA	0.035	0.211	3.029	221	0.005	0.045	6y4zA.pdb.gz
14	PDB:3uwxB	0.025	0.071	3.218	595	0.007	0.022	3uwxB.pdb.gz	Structure and mechanism of the UvrA-UvrB DNA damage sensor.
15	PDB:6exnO	0.027	0.092	3.218	320	0.020	0.119	6exnO.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
16	PDB:7mqaNA	0.020	0.077	3.218	295	0.020	0.129	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:3mcaA	0.017	0.066	3.632	377	0.005	0.024	3mcaA.pdb.gz
18	PDB:1gthA	0.016	0.022	4.355	1019	0.006	0.011	1gthA.pdb.gz	Crystal structure of the productive ternary complex of dihydropyrimidine dehydrogenase with NADPH and 5-iodouracil. Implications for mechanism of inhibition and electron transfer.
19	PDB:3dnyT	0.030	0.076	4.355	654	0.006	0.017	3dnyT.pdb.gz
20	PDB:4yk8A	0.036	0.243	4.355	162	0.008	0.099	4yk8A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9Q777	0.0	2629	1894	0.743	0.746	E9Q777_MOUSE A kinase (PRKA) anchor protein 11 OS=Mus musculus OX=10090 GN=Akap11 PE=1 SV=2
2	Q62924	0.0	1398	1129	0.396	0.667	AKA11_RAT A-kinase anchor protein 11 OS=Rattus norvegicus OX=10116 GN=Akap11 PE=1 SV=1
3	Q6ZQ80	0.0	1325	1023	0.370	0.687	Q6ZQ80_MOUSE MKIAA0629 protein (Fragment) OS=Mus musculus OX=10090 GN=Akap11 PE=2 SV=1
4	Q8BSJ2	0.0	696	521	0.201	0.733	Q8BSJ2_MOUSE A-kinase anchor 110kDa C-terminal domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Akap11 PE=2 SV=1
5	Q9UKA4	0.0	3926	1901	1.000	1.000	AKA11_HUMAN A-kinase anchor protein 11 OS=Homo sapiens OX=9606 GN=AKAP11 PE=1 SV=1
6	Q2M3C7	4.55e-22	107	1700	0.037	0.041	SPKAP_HUMAN A-kinase anchor protein SPHKAP OS=Homo sapiens OX=9606 GN=SPHKAP PE=1 SV=1
7	Q6NSW3	1.47e-20	102	1687	0.038	0.043	SPKAP_MOUSE A-kinase anchor protein SPHKAP OS=Mus musculus OX=10090 GN=Sphkap PE=1 SV=2
8	Q60662	1.56e-06	55.8	849	0.017	0.039	AKAP4_MOUSE A-kinase anchor protein 4 OS=Mus musculus OX=10090 GN=Akap4 PE=1 SV=1
9	O88987	3.60e-06	54.7	864	0.017	0.037	AKAP3_MOUSE A-kinase anchor protein 3 OS=Mus musculus OX=10090 GN=Akap3 PE=1 SV=2
10	O77797	4.18e-06	54.3	858	0.017	0.037	AKAP3_BOVIN A-kinase anchor protein 3 OS=Bos taurus OX=9913 GN=AKAP3 PE=2 SV=2
11	O75969	7.49e-06	53.5	853	0.016	0.036	AKAP3_HUMAN A-kinase anchor protein 3 OS=Homo sapiens OX=9606 GN=AKAP3 PE=1 SV=2
12	Q5JQC9	2.22e-05	52.0	854	0.017	0.037	AKAP4_HUMAN A-kinase anchor protein 4 OS=Homo sapiens OX=9606 GN=AKAP4 PE=1 SV=1
13	Q9SKB3	0.11	39.7	548	0.017	0.058	PARG1_ARATH Poly(ADP-ribose) glycohydrolase 1 OS=Arabidopsis thaliana OX=3702 GN=PARG1 PE=1 SV=2
14	Q84DC3	2.4	35.4	436	0.016	0.071	MDLD_PSEPU NAD(P)-dependent benzaldehyde dehydrogenase OS=Pseudomonas putida OX=303 GN=mdlD PE=1 SV=1
15	P52944	3.4	34.7	327	0.024	0.138	PDLI1_RAT PDZ and LIM domain protein 1 OS=Rattus norvegicus OX=10116 GN=Pdlim1 PE=1 SV=4
16	A0JMW2	7.1	33.9	839	0.018	0.042	DAAF5_XENLA Dynein axonemal assembly factor 5 OS=Xenopus laevis OX=8355 GN=dnaaf5 PE=2 SV=1
17	O80588	7.5	33.9	474	0.013	0.053	EDE1_ARATH Protein ENDOSPERM DEFECTIVE 1 OS=Arabidopsis thaliana OX=3702 GN=EDE1 PE=1 SV=1
18	O00151	8.0	33.5	329	0.021	0.122	PDLI1_HUMAN PDZ and LIM domain protein 1 OS=Homo sapiens OX=9606 GN=PDLIM1 PE=1 SV=4
19	A0A3B6UES5	8.5	33.9	846	0.013	0.030	VINC_OSCPE Vinculin OS=Oscarella pearsei OX=1940113 GN=VIN1 PE=1 SV=1
20	Q9LHG8	9.2	33.5	398	0.016	0.078	ELC_ARATH Protein ELC OS=Arabidopsis thaliana OX=3702 GN=ELC PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000025301

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000274364	0.946	Ras GTPase-activating-like protein IQGAP2
2	9606.ENSP00000268182	0.893	Ras GTPase-activating-like protein IQGAP1
3	9606.ENSP00000324806	0.840	Glycogen synthase kinase-3 beta
4	9606.ENSP00000376475	0.766	cAMP-dependent protein kinase type I-alpha regulatory subunit
5	9606.ENSP00000445786	0.765	Protein FAM216B
6	9606.ENSP00000359719	0.763	cAMP-dependent protein kinase catalytic subunit beta
7	9606.ENSP00000405252	0.752	A-kinase anchor protein 7 isoform gamma
8	9606.ENSP00000341779	0.737	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
9	9606.ENSP00000265563	0.735	cAMP-dependent protein kinase type II-alpha regulatory subunit
10	9606.ENSP00000478212	0.731	A-kinase anchor protein 1, mitochondrial
11	9606.ENSP00000482393	0.731	Iroquois-class homeodomain protein IRX-4
12	9606.ENSP00000331608	0.724	Iroquois-class homeodomain protein IRX-3
13	9606.ENSP00000372056	0.721	Iroquois-class homeodomain protein IRX-2
14	9606.ENSP00000378207	0.696	A-kinase anchor protein 5
15	9606.ENSP00000269701	0.695	A-kinase anchor protein 8
16	9606.ENSP00000368523	0.688	DnaJ homolog subfamily C member 15
17	9606.ENSP00000348573	0.642	A-kinase anchor protein 9
18	9606.ENSP00000305244	0.641	Iroquois-class homeodomain protein IRX-1
19	9606.ENSP00000354718	0.635	A-kinase anchor protein 13
20	9606.ENSP00000366267	0.627	Glypican-5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051018	1.000	protein kinase A binding
GO:0008157	1.000	protein phosphatase 1 binding
GO:0034237	0.483	protein kinase A regulatory subunit binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	1.000	cellular process
GO:0065007	0.999	biological regulation
GO:0050896	0.986	response to stimulus
GO:0050794	0.986	regulation of cellular process
GO:0051716	0.979	cellular response to stimulus
GO:0007154	0.978	cell communication
GO:0023052	0.977	signaling
GO:0007165	0.970	signal transduction
GO:0035556	0.856	intracellular signal transduction
GO:0071840	0.492	cellular component organization or biogenesis
GO:0016043	0.434	cellular component organization
GO:0032501	0.342	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005829	0.999	cytosol
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0031981	0.999	nuclear lumen
GO:0005730	0.984	nucleolus
GO:0005654	0.543	nucleoplasm
GO:0012505	0.314	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]