StarFunc result for job id Q9UKB1

User Input

>input (542 residues)
MEPDSVIEDKTIELMCSVPRSLWLGCANLVESMCALSCLQSMPSVRCLQISNGTSSVIVS
RKRPSEGNYQKEKDLCIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFI
TALPEQGLDHIAENILSYLDARSLCAAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKG
LSERRGWDQYLFKNRPTDGPPNSFYRSLYPKIIQDIETIESNWRCGRHNLQRIQCRSENS
KGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDS
TVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLV
GHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGS
SDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPA
STLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYI
SR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5SRY7	0.948	0.948	2.189E-93	542	0.996	0.996	Q5SRY7.pdb.gz	FBW1B_MOUSE F-box/WD repeat-containing protein 11 OS=Mus musculus OX=10090 GN=Fbxw11 PE=1 SV=1
2	AFDB:A0A2R8QFQ6	0.911	0.880	1.366E-86	562	0.886	0.854	A0A2R8QFQ6.pdb.gz	FB11A_DANRE F-box and WD repeat domain-containing 11-A OS=Danio rerio OX=7955 GN=fbxw11a PE=2 SV=1
3	AFDB:A0A2R8RWN9	0.866	0.879	7.206E-84	534	0.845	0.858	A0A2R8RWN9.pdb.gz	FB11B_DANRE F-box and WD repeat domain-containing 11-B OS=Danio rerio OX=7955 GN=fbxw11b PE=2 SV=1
4	AFDB:A0A0S2Z507	0.790	0.676	4.420E-81	636	0.836	0.712	A0A0S2Z507.pdb.gz	A0A0S2Z507_HUMAN Beta-transducin repeat containing isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=BTRC PE=1 SV=1
5	AFDB:O44382	0.819	0.870	3.022E-76	510	0.710	0.755	O44382.pdb.gz	O44382_DROME Slimb OS=Drosophila melanogaster OX=7227 GN=slmb PE=2 SV=1
6	AFDB:Q09990	0.787	0.645	7.776E-66	665	0.574	0.468	Q09990.pdb.gz	LIN23_CAEEL F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans OX=6239 GN=lin-23 PE=1 SV=2
7	PDB:6ttuT	0.713	0.976	2.220E-61	394	0.668	0.919	6ttuT.pdb.gz	NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.
8	AFDB:P39014	0.565	0.486	1.961E-36	640	0.264	0.223	P39014.pdb.gz	MET30_YEAST F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MET30 PE=1 SV=1
9	AFDB:P87053	0.591	0.533	3.079E-36	605	0.275	0.246	P87053.pdb.gz	POF1_SCHPO F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pof1 PE=1 SV=1
10	AFDB:Q8VBV4	0.515	0.408	1.611E-35	710	0.268	0.204	Q8VBV4.pdb.gz	FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus OX=10090 GN=Fbxw7 PE=1 SV=2
11	AFDB:B8A474	0.511	0.380	2.177E-35	760	0.264	0.188	B8A474.pdb.gz
12	PDB:5mzhB	0.477	0.606	7.411E-25	415	0.183	0.239	5mzhB.pdb.gz
13	PDB:5nnzA	0.444	0.691	2.501E-21	335	0.155	0.251	5nnzA.pdb.gz
14	PDB:7bt6x	0.428	0.470	3.056E-21	488	0.149	0.166	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
15	PDB:2h9lA	0.474	0.782	4.565E-21	321	0.148	0.249	2h9lA.pdb.gz
16	PDB:5jcsq	0.439	0.484	4.565E-21	488	0.144	0.160	5jcsq.pdb.gz	Architecture of the Rix1-Rea1 checkpoint machinery during pre-60S-ribosome remodeling
17	PDB:1vyhC	0.485	0.835	7.925E-21	310	0.151	0.265	1vyhC.pdb.gz
18	PDB:7egeE	0.451	0.447	9.685E-21	547	0.168	0.166	7egeE.pdb.gz
19	PDB:4v7fq	0.420	0.502	1.447E-20	443	0.146	0.178	4v7fq.pdb.gz	60S ribosome biogenesis requires rotation of the 5S ribonucleoprotein particle.
20	PDB:6bk8D	0.479	0.706	3.751E-20	359	0.137	0.206	6bk8D.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KHK1	0.0	812	597	0.708	0.643	A0A0B4KHK1_DROME Supernumerary limbs, isoform B OS=Drosophila melanogaster OX=7227 GN=slmb PE=4 SV=1
2	A0A0S2Z507	0.0	929	636	0.839	0.715	A0A0S2Z507_HUMAN Beta-transducin repeat containing isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=BTRC PE=1 SV=1
3	A0A2R8QFQ6	0.0	989	562	0.886	0.854	FB11A_DANRE F-box and WD repeat domain-containing 11-A OS=Danio rerio OX=7955 GN=fbxw11a PE=2 SV=1
4	A0A2R8RWN9	0.0	954	534	0.843	0.856	FB11B_DANRE F-box and WD repeat domain-containing 11-B OS=Danio rerio OX=7955 GN=fbxw11b PE=2 SV=1
5	B7Z3H4	0.0	950	579	0.845	0.791	B7Z3H4_HUMAN Beta-transducin repeat containing E3 ubiquitin protein ligase OS=Homo sapiens OX=9606 GN=BTRC PE=1 SV=1
6	O44382	0.0	811	510	0.708	0.753	O44382_DROME Slimb OS=Drosophila melanogaster OX=7227 GN=slmb PE=2 SV=1
7	Q09990	0.0	635	665	0.576	0.469	LIN23_CAEEL F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans OX=6239 GN=lin-23 PE=1 SV=2
8	Q3ULA2	0.0	934	605	0.841	0.754	FBW1A_MOUSE F-box/WD repeat-containing protein 1A OS=Mus musculus OX=10090 GN=Btrc PE=1 SV=2
9	Q5SRY7	0.0	1116	542	0.996	0.996	FBW1B_MOUSE F-box/WD repeat-containing protein 11 OS=Mus musculus OX=10090 GN=Fbxw11 PE=1 SV=1
10	Q91854	0.0	894	518	0.784	0.820	TRCB_XENLA Beta-TrCP OS=Xenopus laevis OX=8355 GN=fbxw1 PE=1 SV=1
11	Q9UKB1	0.0	1120	542	1.000	1.000	FBW1B_HUMAN F-box/WD repeat-containing protein 11 OS=Homo sapiens OX=9606 GN=FBXW11 PE=1 SV=1
12	Q9VDE3	0.0	812	510	0.708	0.753	Q9VDE3_DROME LD08669p OS=Drosophila melanogaster OX=7227 GN=slmb PE=1 SV=1
13	Q9Y297	0.0	938	605	0.847	0.759	FBW1A_HUMAN F-box/WD repeat-containing protein 1A OS=Homo sapiens OX=9606 GN=BTRC PE=1 SV=1
14	Q09855	3.07e-74	246	506	0.279	0.298	POF11_SCHPO F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pof11 PE=1 SV=2
15	B7ZDC8	6.49e-70	236	544	0.258	0.257	B7ZDC8_DANRE F-box and WD repeat domain-containing 7 OS=Danio rerio OX=7955 GN=fbxw7 PE=4 SV=1
16	Q969H0	8.40e-69	236	707	0.256	0.197	FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens OX=9606 GN=FBXW7 PE=1 SV=1
17	Q8VBV4	1.29e-68	236	710	0.262	0.200	FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus OX=10090 GN=Fbxw7 PE=1 SV=2
18	Q9VZF4	4.80e-67	238	1326	0.284	0.116	FBXW7_DROME F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster OX=7227 GN=ago PE=1 SV=1
19	P87053	7.99e-58	204	605	0.268	0.240	POF1_SCHPO F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pof1 PE=1 SV=1
20	P39014	1.86e-48	179	640	0.245	0.208	MET30_YEAST F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MET30 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	4.5e-07	41.4	Anaphase-promoting complex subunit 4 WD40 domain
2	PF12125 Beta-TrCP_D	1e-22	91.2	D domain of beta-TrCP
3	PF07433 DUF1513	63	14.0	Protein of unknown function (DUF1513)
4	PF14969 DUF4508	2.9e+02	13.2	Domain of unknown function (DUF4508)
5	PF19235 DUF5888	1e+02	14.2	Family of unknown function (DUF5888)
6	PF19686 DUF6188	4e+02	12.7	Family of unknown function (DUF6188)
7	PF08662 eIF2A	67	14.8	Eukaryotic translation initiation factor eIF2A
8	PF00646 F-box	0.016	26.3	F-box domain
9	PF12937 F-box-like	4e-06	37.9	F-box-like
10	PF11768 Frtz	24	14.7	WD repeat-containing and planar cell polarity effector protein Fritz
11	PF20426 NBCH_WD40	0.0005	30.6	Neurobeachin beta propeller domain
12	PF11715 Nup160	0.18	22.2	Nucleoporin Nup120/160
13	PF00400 WD40	1.8e-36	134.7	WD domain, G-beta repeat
14	PF19056 WD40_2	1.9e+02	12.0	WD40 repeated domain
15	PF17005 WD40_like	0.0041	28.1	WD40-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 118797.XP_007465595.1

Rank	PPI partner	STRING score	Description
1	118797.XP_007464529.1	0.994	Catenin beta-1 isoform X1
2	118797.XP_007447863.1	0.992	Belongs to the SKP1 family.
3	118797.XP_007469928.1	0.992	Belongs to the cullin family. ProRule:PRU00330, ECO:0000256\|RuleBase:RU003829,
4	118797.XP_007472287.1	0.992	Belongs to the SKP1 family.
5	118797.XP_007454163.1	0.987	Ring-box 1
6	118797.XP_007468257.1	0.976	GLI family zinc finger 3
7	118797.XP_007469724.1	0.972	Zinc finger protein GLI2
8	118797.XP_007467733.1	0.965	GLI family zinc finger 1
9	118797.XP_007470519.1	0.963	Beta-transducin repeat containing E3 ubiquitin protein ligase
10	118797.XP_007464888.1	0.959	NFKB inhibitor alpha
11	118797.XP_007471363.1	0.939	WW domain-containing transcription regulator protein 1
12	118797.XP_007447169.1	0.934	Yorkie homolog isoform X1
13	118797.XP_007448626.1	0.934	Yes associated protein 1
14	118797.XP_007458800.1	0.933	F-box protein 5
15	118797.XP_007466764.1	0.932	F-box/WD repeat-containing protein 7 isoform X1
16	118797.XP_007446316.1	0.919	Serine/threonine-protein kinase PLK4 isoform X1
17	118797.XP_007461901.1	0.915	S-phase kinase-associated protein 2 isoform X1
18	118797.XP_007469463.1	0.905	CD4 molecule
19	118797.XP_007470767.1	0.901	Ras association domain family member 5
20	118797.XP_007452950.1	0.895	Period circadian clock 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.962	catalytic activity
GO:0140096	0.954	catalytic activity, acting on a protein
GO:0016740	0.947	transferase activity
GO:0004842	0.910	ubiquitin-protein transferase activity
GO:0061659	0.369	ubiquitin-like protein ligase activity
GO:0060090	0.329	molecular adaptor activity
GO:0061630	0.320	ubiquitin protein ligase activity
GO:0030674	0.301	protein-macromolecule adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.993	primary metabolic process
GO:0006807	0.992	nitrogen compound metabolic process
GO:0009987	0.991	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0009057	0.986	macromolecule catabolic process
GO:0043412	0.982	macromolecule modification
GO:0080090	0.979	regulation of primary metabolic process
GO:0030163	0.979	protein catabolic process
GO:0031146	0.969	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
GO:0048518	0.968	positive regulation of biological process
GO:0032446	0.967	protein modification by small protein conjugation
GO:0051171	0.966	regulation of nitrogen compound metabolic process
GO:0000209	0.961	protein polyubiquitination
GO:0060255	0.958	regulation of macromolecule metabolic process
GO:0048519	0.914	negative regulation of biological process
GO:0031323	0.812	regulation of cellular metabolic process
GO:0009889	0.792	regulation of biosynthetic process
GO:0010605	0.792	negative regulation of macromolecule metabolic process
GO:0031648	0.773	protein destabilization
GO:0048523	0.746	negative regulation of cellular process
GO:0009893	0.735	positive regulation of metabolic process
GO:0010556	0.734	regulation of macromolecule biosynthetic process
GO:0010604	0.733	positive regulation of macromolecule metabolic process
GO:0010468	0.723	regulation of gene expression
GO:0048522	0.721	positive regulation of cellular process
GO:0051173	0.714	positive regulation of nitrogen compound metabolic process
GO:0019219	0.710	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.706	regulation of cellular biosynthetic process
GO:0051252	0.699	regulation of RNA metabolic process
GO:1903506	0.685	regulation of nucleic acid-templated transcription
GO:0006355	0.683	regulation of DNA-templated transcription
GO:0050896	0.652	response to stimulus
GO:0042752	0.632	regulation of circadian rhythm
GO:0031325	0.604	positive regulation of cellular metabolic process
GO:0032502	0.587	developmental process
GO:0051246	0.558	regulation of protein metabolic process
GO:0023051	0.500	regulation of signaling
GO:0010646	0.479	regulation of cell communication
GO:0048583	0.475	regulation of response to stimulus
GO:0009966	0.437	regulation of signal transduction
GO:0031324	0.430	negative regulation of cellular metabolic process
GO:0051172	0.426	negative regulation of nitrogen compound metabolic process
GO:0051716	0.401	cellular response to stimulus
GO:0048856	0.388	anatomical structure development
GO:0032501	0.334	multicellular organismal process
GO:0065009	0.320	regulation of molecular function
GO:0009890	0.310	negative regulation of biosynthetic process
GO:0051247	0.305	positive regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005829	0.999	cytosol
GO:0005634	0.999	nucleus
GO:1902494	0.994	catalytic complex
GO:0140535	0.987	intracellular protein-containing complex
GO:1990234	0.984	transferase complex
GO:0031461	0.967	cullin-RING ubiquitin ligase complex
GO:0031974	0.965	membrane-enclosed lumen
GO:0070013	0.958	intracellular organelle lumen
GO:0031981	0.952	nuclear lumen
GO:0019005	0.948	SCF ubiquitin ligase complex
GO:0005654	0.940	nucleoplasm
GO:0043232	0.818	intracellular non-membrane-bounded organelle
GO:0005856	0.302	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.947	Transferases.

[back to server]