StarFunc result for job id Q9UKB5

User Input

>input (411 residues)
MWIQQLLGLSSMSIRWPGRPLGSHAWILIAMFQLAVDLPACEALGPGPEFWLLPRSPPRP
PRLWSFRSGQPARVPAPVWSPRPPRVERIHGQMQMPRARRAHRPRDQAAALVPKAGLAKP
PAAAKSSPSLASSSSSSSSAVAGGAPEQQALLRRGKRHLQGDGLSSFDSRGSRPTTETEF
IAWGPTGDEEALESNTFPGVYGPTTVSILQTRKTTVAATTTTTTTATPMTLQTKGFTESL
DPRRRIPGGVSTTEPSTSPSNNGEVTQPPRILGEASGLAVHQIITITVSLIMVIAALITT
LVLKNCCAQSGNTRRNSHQRKTNQQEESCQNLTDFPSARVPSSLDIFTAYNETLQCSHEC
VRASVPVYTDETLHSTTGEYKSTFNGNRPSSSDRHLIPVAFVSEKWFEISC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UKB5	0.999	0.999	6.392E-60	411	1.000	1.000	Q9UKB5.pdb.gz	AJAP1_HUMAN Adherens junction-associated protein 1 OS=Homo sapiens OX=9606 GN=AJAP1 PE=1 SV=1
2	AFDB:O60187	0.080	0.053	2.253E-3	660	0.117	0.073	O60187.pdb.gz	SID4_SCHPO Septation initiation protein sid4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sid4 PE=1 SV=1
3	AFDB:Q9W266	0.136	0.095	2.427E-3	677	0.119	0.072	Q9W266.pdb.gz	WDP_DROME Protein windpipe OS=Drosophila melanogaster OX=7227 GN=wdp PE=1 SV=1
4	AFDB:R4GLV5	0.117	0.054	5.496E-3	1116	0.170	0.063	R4GLV5.pdb.gz
5	AFDB:A0A2R8RUQ1	0.073	0.044	5.920E-3	828	0.185	0.092	A0A2R8RUQ1.pdb.gz
6	AFDB:Q8MRW5	0.101	0.069	8.584E-3	640	0.151	0.097	Q8MRW5.pdb.gz	ET96B_DROME ETV5-related protein Ets96B OS=Drosophila melanogaster OX=7227 GN=Ets96B PE=2 SV=1
7	AFDB:A0A2R8QB31	0.098	0.062	2.094E-2	797	0.182	0.094	A0A2R8QB31.pdb.gz	A0A2R8QB31_DANRE PHD finger protein 21A isoform X7 OS=Danio rerio OX=7955 GN=phf21ab PE=1 SV=1
8	AFDB:Q24146	0.094	0.048	2.094E-2	1113	0.134	0.049	Q24146.pdb.gz	Q24146_DROME HLH106 OS=Drosophila melanogaster OX=7227 GN=SREBP PE=2 SV=1
9	AFDB:C9JFV4	0.111	0.049	2.617E-2	1180	0.170	0.059	C9JFV4.pdb.gz	C9JFV4_HUMAN Proline-, glutamic acid- and leucine-rich protein 1 OS=Homo sapiens OX=9606 GN=PELP1 PE=1 SV=2
10	AFDB:A9VAD3	0.090	0.058	2.819E-2	819	0.139	0.070	A9VAD3.pdb.gz	A9VAD3_MONBE Large ribosomal subunit protein uL2 C-terminal domain-containing protein OS=Monosiga brevicollis OX=81824 GN=MONBRDRAFT_34232 PE=1 SV=1
11	PDB:7mqaNA	0.054	0.071	2.486	295	0.039	0.054	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:2dyrI	0.092	0.303	3.882	73	0.034	0.192	2dyrI.pdb.gz	Structures and physiological roles of 13 integral lipids of bovine heart cytochrome c oxidase
13	PDB:7mqaSS	0.063	0.073	4.504	350	0.054	0.063	7mqaSS.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UKB5	0.0	835	411	1.000	1.000	AJAP1_HUMAN Adherens junction-associated protein 1 OS=Homo sapiens OX=9606 GN=AJAP1 PE=1 SV=1
2	Q388U8	0.37	35.4	806	0.088	0.045	Q388U8_TRYB2 Methyltransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.0530 PE=3 SV=1
3	Q8IYJ0	0.59	34.3	282	0.044	0.064	PIANP_HUMAN PILR alpha-associated neural protein OS=Homo sapiens OX=9606 GN=PIANP PE=1 SV=1
4	Q5U2P6	0.67	34.3	272	0.044	0.066	PIANP_RAT PILR alpha-associated neural protein OS=Rattus norvegicus OX=10116 GN=Pianp PE=2 SV=1
5	Q50EL0	1.3	33.5	459	0.063	0.057	DMAW_ASPFU Tryptophan dimethylallyltransferase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=dmaW PE=1 SV=2
6	Q22747	6.4	31.6	588	0.046	0.032	TM201_CAEEL Transmembrane protein 201 homolog OS=Caenorhabditis elegans OX=6239 GN=samp-1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15298 AJAP1_PANP_C	1.2e-99	344.2	AJAP1/PANP C-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367433

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000333769	0.960	Basigin
2	9606.ENSP00000261769	0.938	Cadherin-1
3	9606.ENSP00000344456	0.817	Catenin beta-1
4	9606.ENSP00000300026	0.729	Peptidyl-prolyl cis-trans isomerase B
5	9606.ENSP00000306900	0.690	Prion-like protein doppel
6	9606.ENSP00000433712	0.662	Shadow of prion protein
7	9606.ENSP00000442157	0.662	PILR alpha-associated neural protein
8	9606.ENSP00000364467	0.652	Lysozyme-like protein 2
9	9606.ENSP00000419425	0.648	Peptidyl-prolyl cis-trans isomerase A
10	9606.ENSP00000269141	0.641	Cadherin-2
11	9606.ENSP00000481750	0.634	AP-5 complex subunit sigma-1
12	9606.ENSP00000394899	0.615	Transmembrane protein 51
13	9606.ENSP00000369291	0.552	LETM1 domain-containing protein LETM2, mitochondrial
14	9606.ENSP00000355306	0.547	UPF0688 protein C1orf174
15	9606.ENSP00000368752	0.537	Major prion protein
16	9606.ENSP00000350833	0.524	Metallophosphoesterase MPPED2
17	9606.ENSP00000377616	0.513	Keratin-like protein KRT222
18	9606.ENSP00000306522	0.508	Calmodulin-binding transcription activator 1
19	9606.ENSP00000358529	0.505	Tetraspanin-2
20	9606.ENSP00000467218	0.502	Zinc finger protein 570

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0008013	1.000	beta-catenin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0048523	0.926	negative regulation of cellular process
GO:0051239	0.890	regulation of multicellular organismal process
GO:0048583	0.821	regulation of response to stimulus
GO:0050793	0.801	regulation of developmental process
GO:0009987	0.786	cellular process
GO:0080134	0.741	regulation of response to stress
GO:0010810	0.709	regulation of cell-substrate adhesion
GO:0048585	0.675	negative regulation of response to stimulus
GO:2000027	0.670	regulation of animal organ morphogenesis
GO:0032101	0.650	regulation of response to external stimulus
GO:1903034	0.580	regulation of response to wounding
GO:0007162	0.556	negative regulation of cell adhesion
GO:2000026	0.555	regulation of multicellular organismal development
GO:0030856	0.528	regulation of epithelial cell differentiation
GO:0061041	0.526	regulation of wound healing
GO:1903035	0.501	negative regulation of response to wounding
GO:0032102	0.497	negative regulation of response to external stimulus
GO:0050896	0.450	response to stimulus
GO:0048518	0.428	positive regulation of biological process
GO:0048522	0.318	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070161	0.997	anchoring junction
GO:0098590	0.996	plasma membrane region
GO:0045178	0.995	basal part of cell
GO:0098552	0.990	side of membrane
GO:0009986	0.989	cell surface
GO:0005912	0.989	adherens junction
GO:0016323	0.989	basolateral plasma membrane
GO:0009898	0.982	cytoplasmic side of plasma membrane
GO:0044291	0.981	cell-cell contact zone
GO:0005622	0.801	intracellular anatomical structure
GO:0043226	0.795	organelle
GO:0043229	0.788	intracellular organelle
GO:0043227	0.700	membrane-bounded organelle
GO:0005737	0.686	cytoplasm
GO:0043231	0.630	intracellular membrane-bounded organelle
GO:0009897	0.405	external side of plasma membrane
GO:0012505	0.312	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]