StarFunc result for job id Q9UKC9

User Input

>input (423 residues)
MVFSNNDEGLINKKLPKELLLRIFSFLDIVTLCRCAQISKAWNILALDGSNWQRIDLFNF
QTDVEGRVVENISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDS
TCYSLSRFCSKLKHLDLTSCVSITNSSLKGISEGCRNLEYLNLSWCDQITKDGIEALVRG
CRGLKALLLRGCTQLEDEALKHIQNYCHELVSLNLQSCSRITDEGVVQICRGCHRLQALC
LSGCSNLTDASLTALGLNCPRLQILEAARCSHLTDAGFTLLARNCHELEKMDLEECILIT
DSTLIQLSIHCPKLQALSLSHCELITDDGILHLSNSTCGHERLRVLELDNCLLITDVALE
HLENCRGLERLELYDCQQVTRAGIKRMRAQLPHVKVHAYFAPVTPPTAVAGSGQRLCRCC
VIL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BH16	0.960	0.960	2.336E-74	423	0.960	0.960	Q8BH16.pdb.gz	FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus OX=10090 GN=Fbxl2 PE=1 SV=1
2	AFDB:Q96IG2	0.979	0.950	4.421E-67	436	0.780	0.757	Q96IG2.pdb.gz	FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens OX=9606 GN=FBXL20 PE=1 SV=2
3	PDB:6o60C	0.877	0.952	6.153E-65	389	0.920	1.000	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.
4	AFDB:A8DYA6	0.943	0.617	1.657E-54	651	0.546	0.355	A8DYA6.pdb.gz	A8DYA6_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9003 PE=4 SV=1
5	AFDB:P34284	0.948	0.863	3.433E-51	466	0.485	0.440	P34284.pdb.gz	FBXL_CAEEL F-box/LRR-repeat protein fbxl-1 OS=Caenorhabditis elegans OX=6239 GN=fbxl-1 PE=2 SV=3
6	AFDB:Q5BJ29	0.725	0.632	3.402E-30	491	0.258	0.222	Q5BJ29.pdb.gz	FBXL7_MOUSE F-box/LRR-repeat protein 7 OS=Mus musculus OX=10090 GN=Fbxl7 PE=1 SV=1
7	AFDB:Q8NEE6	0.334	0.230	6.949E-30	735	0.279	0.161	Q8NEE6.pdb.gz	FXL13_HUMAN F-box and leucine-rich repeat protein 13 OS=Homo sapiens OX=9606 GN=FBXL13 PE=2 SV=3
8	AFDB:Q8CDU4	0.405	0.263	3.063E-29	790	0.246	0.132	Q8CDU4.pdb.gz	FXL13_MOUSE F-box and leucine-rich repeat protein 13 OS=Mus musculus OX=10090 GN=Fbxl13 PE=1 SV=2
9	AFDB:C8V4D4	0.799	0.589	5.022E-29	585	0.251	0.181	C8V4D4.pdb.gz	GRRA_EMENI SCF E3 ubiquitin ligase complex F-box protein grrA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=grrA PE=2 SV=1
10	AFDB:Q6TGX5	0.793	0.815	7.794E-29	411	0.277	0.285	Q6TGX5.pdb.gz	Q6TGX5_DANRE F-box and leucine-rich repeat protein 14a OS=Danio rerio OX=7955 GN=wu:fi25d04 PE=2 SV=1
11	AFDB:B1H1X1	0.778	0.501	3.078E-28	673	0.203	0.128	B1H1X1.pdb.gz	FXL17_XENLA F-box/LRR-repeat protein 17 OS=Xenopus laevis OX=8355 GN=fbxl17 PE=2 SV=1
12	PDB:3oglB	0.504	0.397	1.424E-15	568	0.177	0.132	3oglB.pdb.gz	Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor.
13	PDB:1a4yA	0.512	0.480	8.263E-15	460	0.206	0.189	1a4yA.pdb.gz
14	PDB:7sa1B	0.594	0.424	1.512E-14	624	0.206	0.139	7sa1B.pdb.gz
15	PDB:2p1nB	0.450	0.359	4.065E-14	571	0.220	0.163	2p1nB.pdb.gz	Mechanism of auxin perception by the TIR1 ubiquitin ligase
16	PDB:7b5mT	0.421	0.519	2.937E-13	325	0.196	0.255	7b5mT.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
17	PDB:4i6jB	0.550	0.583	1.044E-11	394	0.173	0.185	4i6jB.pdb.gz
18	PDB:5hywA	0.362	0.279	3.310E-11	580	0.203	0.148	5hywA.pdb.gz
19	PDB:7pmkL	0.555	0.503	6.058E-11	475	0.187	0.166	7pmkL.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
20	PDB:7pzcA	0.550	0.249	9.401E-11	1010	0.220	0.092	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BH16	0.0	828	423	0.960	0.960	FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus OX=10090 GN=Fbxl2 PE=1 SV=1
2	Q96IG2	0.0	694	436	0.780	0.757	FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens OX=9606 GN=FBXL20 PE=1 SV=2
3	Q9CZV8	0.0	692	436	0.778	0.755	FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus OX=10090 GN=Fbxl20 PE=1 SV=3
4	Q9UKC9	0.0	849	423	1.000	1.000	FBXL2_HUMAN F-box/LRR-repeat protein 2 OS=Homo sapiens OX=9606 GN=FBXL2 PE=1 SV=3
5	A8DYA5	1.92e-162	465	426	0.548	0.545	A8DYA5_DROME LP16447p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9003 PE=2 SV=1
6	Q5BI22	2.92e-162	465	437	0.548	0.531	Q5BI22_DROME LD12638p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9003 PE=2 SV=1
7	A1Z8M8	3.32e-162	466	464	0.548	0.500	A1Z8M8_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=FBXL2 PE=4 SV=1
8	A0A0B4KEK4	5.85e-162	465	455	0.548	0.510	A0A0B4KEK4_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9003 PE=4 SV=1
9	A0A0B4KEU4	1.21e-161	466	497	0.548	0.467	A0A0B4KEU4_DROME Uncharacterized protein, isoform F OS=Drosophila melanogaster OX=7227 GN=FBXL2 PE=4 SV=1
10	A8DYA6	3.79e-160	468	651	0.548	0.356	A8DYA6_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9003 PE=4 SV=1
11	P34284	1.10e-144	422	466	0.482	0.438	FBXL_CAEEL F-box/LRR-repeat protein fbxl-1 OS=Caenorhabditis elegans OX=6239 GN=fbxl-1 PE=2 SV=3
12	Q5BJ29	8.56e-46	167	491	0.236	0.204	FBXL7_MOUSE F-box/LRR-repeat protein 7 OS=Mus musculus OX=10090 GN=Fbxl7 PE=1 SV=1
13	Q9UJT9	1.43e-45	166	491	0.236	0.204	FBXL7_HUMAN F-box/LRR-repeat protein 7 OS=Homo sapiens OX=9606 GN=FBXL7 PE=1 SV=1
14	Q8N1E6	4.86e-42	155	418	0.300	0.304	FXL14_HUMAN F-box/LRR-repeat protein 14 OS=Homo sapiens OX=9606 GN=FBXL14 PE=1 SV=1
15	Q5RH13	7.84e-42	154	400	0.300	0.318	Q5RH13_DANRE F-box and leucine-rich repeat protein 14b OS=Danio rerio OX=7955 GN=fbxl14 PE=2 SV=1
16	Q6TGX5	1.06e-41	154	411	0.291	0.299	Q6TGX5_DANRE F-box and leucine-rich repeat protein 14a OS=Danio rerio OX=7955 GN=wu:fi25d04 PE=2 SV=1
17	Q9VF10	2.43e-40	155	772	0.267	0.146	Q9VF10_DROME F-box and leucine-rich repeat protein 7 OS=Drosophila melanogaster OX=7227 GN=Fbxl7 PE=1 SV=2
18	Q8NEE6	1.88e-39	152	735	0.253	0.146	FXL13_HUMAN F-box and leucine-rich repeat protein 13 OS=Homo sapiens OX=9606 GN=FBXL13 PE=2 SV=3
19	Q9C5D2	4.45e-38	147	610	0.234	0.162	FBL4_ARATH F-box/LRR-repeat protein 4 OS=Arabidopsis thaliana OX=3702 GN=FBL4 PE=2 SV=1
20	C8V4D4	3.05e-33	133	585	0.253	0.183	GRRA_EMENI SCF E3 ubiquitin ligase complex F-box protein grrA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=grrA PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00646 F-box	0.00038	31.5	F-box domain
2	PF12937 F-box-like	3.6e-08	44.5	F-box-like
3	PF15966 F-box_4	33	15.7	F-box
4	PF00560 LRR_1	0.0037	28.4	Leucine Rich Repeat
5	PF12799 LRR_4	7.2e-12	56.6	Leucine Rich repeats (2 copies)
6	PF13516 LRR_6	4.3e-18	74.8	Leucine Rich repeat
7	PF13855 LRR_8	1.7	19.8	Leucine rich repeat
8	PF12731 Mating_N	1.6e+02	13.8	Mating-type protein beta 1
9	PF02195 ParBc	4.8e+02	12.3	ParB/Sulfiredoxin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000005624

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000009838	0.977	Belongs to the SKP1 family.
2	61853.ENSNLEP00000023253	0.911	Cullin 1
3	61853.ENSNLEP00000011699	0.819	Catalyzes the transfer of a geranylgeranyl moiety from geranylgeranyl diphosphate to both cysteines of proteins with the C- terminal sequence -XXCC, -XCXC and -CCXX.
4	61853.ENSNLEP00000000821	0.777	Protein prenyltransferase alpha subunit repeat containing 1
5	61853.ENSNLEP00000007175	0.711	Uncharacterized protein
6	61853.ENSNLEP00000018730	0.656	Ring-box 1, E3 ubiquitin protein ligase
7	61853.ENSNLEP00000005870	0.635	Cyclin D3
8	61853.ENSNLEP00000021760	0.587	F-box protein 3
9	61853.ENSNLEP00000001881	0.551	F-box protein 45
10	61853.ENSNLEP00000011891	0.537	Cullin 3
11	61853.ENSNLEP00000020190	0.537	Belongs to the cullin family.
12	61853.ENSNLEP00000022932	0.521	Ribosomal protein S11
13	61853.ENSNLEP00000007348	0.517	Kelch-like family member 24
14	61853.ENSNLEP00000014280	0.507	Protein geranylgeranyltransferase type I, beta subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1990756	0.720	ubiquitin ligase-substrate adaptor activity
GO:0019899	0.353	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.984	cellular process
GO:0071704	0.983	organic substance metabolic process
GO:0050789	0.983	regulation of biological process
GO:0044238	0.981	primary metabolic process
GO:0050794	0.953	regulation of cellular process
GO:0044237	0.948	cellular metabolic process
GO:0006807	0.932	nitrogen compound metabolic process
GO:0006511	0.924	ubiquitin-dependent protein catabolic process
GO:0043161	0.912	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0031146	0.867	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
GO:0070647	0.823	protein modification by small protein conjugation or removal
GO:0048583	0.766	regulation of response to stimulus
GO:0016567	0.741	protein ubiquitination
GO:0050896	0.700	response to stimulus
GO:0023051	0.660	regulation of signaling
GO:0010646	0.660	regulation of cell communication
GO:0019222	0.496	regulation of metabolic process
GO:0048518	0.466	positive regulation of biological process
GO:0060255	0.399	regulation of macromolecule metabolic process
GO:0080090	0.395	regulation of primary metabolic process
GO:0051171	0.395	regulation of nitrogen compound metabolic process
GO:0031323	0.390	regulation of cellular metabolic process
GO:0048519	0.388	negative regulation of biological process
GO:0048523	0.337	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0005829	0.991	cytosol
GO:0016020	0.990	membrane
GO:0032991	0.971	protein-containing complex
GO:1990234	0.842	transferase complex
GO:0005634	0.824	nucleus
GO:0140535	0.821	intracellular protein-containing complex
GO:0000151	0.731	ubiquitin ligase complex
GO:0031461	0.718	cullin-RING ubiquitin ligase complex
GO:0019005	0.694	SCF ubiquitin ligase complex
GO:0043233	0.377	organelle lumen
GO:0070013	0.356	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]