StarFunc result for job id Q9UKG1

User Input

>input (709 residues)
MPGIDKLPIEETLEDSPQTRSLLGVFEEDATAISNYMNQLYQAMHRIYDAQNELSAATHL
TSKLLKEYEKQRFPLGGDDEVMSSTLQQFSKVIDELSSCHAVLSTQLADAMMFPITQFKE
RDLKEILTLKEVFQIASNDHDAAINRYSRLSKKRENDKVKYEVTEDVYTSRKKQHQTMMH
YFCALNTLQYKKKIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLANIGTSVQNVRREM
DSDIETMQQTIEDLEVASDPLYVPDPDPTKFPVNRNLTRKAGYLNARNKTGLVSSTWDRQ
FYFTQGGNLMSQARGDVAGGLAMDIDNCSVMAVDCEDRRYCFQITSFDGKKSSILQAESK
KDHEEWICTINNISKQIYLSENPEETAARVNQSALEAVTPSPSFQQRHESLRPAAGQSRP
PTARTSSSGSLGSESTNLAALSLDSLVAPDTPIQFDIISPVCEDQPGQAKAFGQGGRRTN
PFGESGGSTKSETEDSILHQLFIVRFLGSMEVKSDDHPDVVYETMRQILAARAIHNIFRM
TESHLLVTCDCLKLIDPQTQVTRLTFPLPCVVLYATHQENKRLFGFVLRTSSGRSESNLS
SVCYIFESNNEGEKICDSVGLAKQIALHAELDRRASEKQKEIERVKEKQQKELNKQKQIE
KDLEEQSRLIAASSRPNQASSEGQFVVLSSSQSEESDLGEGGKKRESEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UKG1	1.000	1.000	0.000	709	1.000	1.000	Q9UKG1.pdb.gz	DP13A_HUMAN DCC-interacting protein 13-alpha OS=Homo sapiens OX=9606 GN=APPL1 PE=1 SV=1
2	AFDB:A0A2R8QM99	0.531	0.525	4.649E-87	718	0.795	0.786	A0A2R8QM99.pdb.gz
3	AFDB:Q8NEU8	0.627	0.664	1.642E-65	664	0.480	0.512	Q8NEU8.pdb.gz	DP13B_HUMAN DCC-interacting protein 13-beta OS=Homo sapiens OX=9606 GN=APPL2 PE=1 SV=3
4	AFDB:B2XCM0	0.647	0.689	1.035E-64	662	0.477	0.511	B2XCM0.pdb.gz	B2XCM0_DANRE Appl2 OS=Danio rerio OX=7955 GN=appl2 PE=1 SV=1
5	AFDB:Q3UH98	0.413	0.359	5.651E-20	833	0.140	0.119	Q3UH98.pdb.gz	Q3UH98_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
6	AFDB:Q551Q8	0.388	0.337	7.200E-20	843	0.135	0.114	Q551Q8.pdb.gz	Q551Q8_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0276395 PE=4 SV=1
7	AFDB:Q15057	0.414	0.381	1.383E-18	778	0.121	0.111	Q15057.pdb.gz	ACAP2_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ACAP2 PE=1 SV=3
8	AFDB:Q15027	0.382	0.368	2.357E-18	740	0.121	0.116	Q15027.pdb.gz	ACAP1_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ACAP1 PE=1 SV=1
9	AFDB:Q9VCQ6	0.417	0.362	2.862E-18	828	0.123	0.105	Q9VCQ6.pdb.gz	Q9VCQ6_DROME Centaurin beta 1A OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=1 SV=1
10	AFDB:Q9FIT8	0.338	0.298	4.017E-18	828	0.150	0.128	Q9FIT8.pdb.gz	AGD1_ARATH ADP-ribosylation factor GTPase-activating protein AGD1 OS=Arabidopsis thaliana OX=3702 GN=AGD1 PE=2 SV=2
11	PDB:6u3eA	0.133	0.231	1.127E-4	397	0.034	0.060	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
12	PDB:4mt6A	0.126	0.222	1.830E-4	389	0.059	0.108	4mt6A.pdb.gz
13	PDB:3ljuX	0.126	0.227	2.696E-4	373	0.032	0.062	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
14	PDB:6ikoA	0.172	0.374	3.118E-4	303	0.044	0.102	6ikoA.pdb.gz
15	PDB:7rx9A	0.121	0.189	6.770E-4	432	0.062	0.102	7rx9A.pdb.gz
16	PDB:7c3mA	0.119	0.144	9.054E-4	577	0.048	0.059	7c3mA.pdb.gz
17	PDB:4mk0A	0.138	0.154	1.334E-3	631	0.034	0.038	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
18	PDB:3pvuA	0.130	0.150	1.700E-3	609	0.042	0.049	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
19	PDB:6bbpA	0.123	0.166	2.273E-3	520	0.032	0.044	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
20	PDB:3uzsA	0.136	0.157	3.191E-3	609	0.031	0.036	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZXF9	0.0	1190	644	0.834	0.918	A0A8I5ZXF9_RAT Adaptor protein, phosphotyrosine interacting with PH domain and leucine zipper 1 OS=Rattus norvegicus OX=10116 GN=Appl1 PE=1 SV=1
2	B2XCL9	0.0	1173	707	0.803	0.805	B2XCL9_DANRE Appl1 OS=Danio rerio OX=7955 GN=appl1 PE=1 SV=1
3	B2XCM0	0.0	684	662	0.481	0.515	B2XCM0_DANRE Appl2 OS=Danio rerio OX=7955 GN=appl2 PE=1 SV=1
4	D3ZWA8	0.0	1433	707	0.976	0.979	D3ZWA8_RAT Adaptor protein, phosphotyrosine interacting with PH domain and leucine zipper 1 OS=Rattus norvegicus OX=10116 GN=Appl1 PE=1 SV=4
5	F1RB27	0.0	683	662	0.481	0.515	F1RB27_DANRE Adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper-containing 2 OS=Danio rerio OX=7955 GN=appl2 PE=1 SV=1
6	Q8K3G9	0.0	695	662	0.475	0.509	DP13B_MOUSE DCC-interacting protein 13-beta OS=Mus musculus OX=10090 GN=Appl2 PE=1 SV=1
7	Q8K3H0	0.0	1441	707	0.980	0.983	DP13A_MOUSE DCC-interacting protein 13-alpha OS=Mus musculus OX=10090 GN=Appl1 PE=1 SV=1
8	Q8NEU8	0.0	708	664	0.485	0.518	DP13B_HUMAN DCC-interacting protein 13-beta OS=Homo sapiens OX=9606 GN=APPL2 PE=1 SV=3
9	Q9UKG1	0.0	1475	709	1.000	1.000	DP13A_HUMAN DCC-interacting protein 13-alpha OS=Homo sapiens OX=9606 GN=APPL1 PE=1 SV=1
10	Q3UH98	8.11e-23	106	833	0.133	0.113	Q3UH98_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
11	Q4QQN0	8.66e-23	105	626	0.133	0.150	Q4QQN0_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
12	Q6NXL5	1.22e-22	105	833	0.133	0.113	Q6NXL5_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=1 SV=1
13	A2ADA6	2.57e-22	104	829	0.133	0.113	A2ADA6_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=1 SV=1
14	Q5FVC7	3.73e-21	100	770	0.126	0.116	ACAP2_RAT Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Acap2 PE=1 SV=1
15	Q15057	4.57e-21	100	778	0.124	0.113	ACAP2_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ACAP2 PE=1 SV=3
16	Q6ZQK5	1.33e-20	99.4	770	0.124	0.114	ACAP2_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Mus musculus OX=10090 GN=Acap2 PE=1 SV=2
17	Q6Y5D8	1.39e-17	89.7	786	0.118	0.107	RHG10_MOUSE Rho GTPase-activating protein 10 OS=Mus musculus OX=10090 GN=Arhgap10 PE=1 SV=2
18	A1A4S6	5.28e-17	87.8	786	0.117	0.106	RHG10_HUMAN Rho GTPase-activating protein 10 OS=Homo sapiens OX=9606 GN=ARHGAP10 PE=1 SV=1
19	Q9VCQ6	9.64e-16	84.0	828	0.113	0.097	Q9VCQ6_DROME Centaurin beta 1A OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=1 SV=1
20	Q8T0R1	1.03e-15	83.6	767	0.113	0.104	Q8T0R1_DROME GH12888p OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03114 BAR	8.5	17.5	BAR domain
2	PF16746 BAR_3	5.1e-65	231.0	BAR domain of APPL family
3	PF07889 DUF1664	8.7e+02	11.4	Protein of unknown function (DUF1664)
4	PF06372 Gemin6	4.6e+02	12.2	Gemin6 Sm-like domain
5	PF00169 PH	0.0006	31.6	PH domain
6	PF15410 PH_9	2.5e+02	13.2	Pleckstrin homology domain
7	PF00640 PID	7.8e-07	40.7	Phosphotyrosine interaction domain (PTB/PID)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000008854

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000019838	0.978	V-akt murine thymoma viral oncogene homolog 1
2	61853.ENSNLEP00000024406	0.976	RAB5A, member RAS oncogene family
3	61853.ENSNLEP00000021993	0.974	Adiponectin receptor 1
4	61853.ENSNLEP00000008085	0.964	Adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 2
5	61853.ENSNLEP00000023305	0.943	Adiponectin receptor 2
6	61853.ENSNLEP00000013240	0.939	Caspase 3, apoptosis-related cysteine peptidase
7	61853.ENSNLEP00000014442	0.923	DCC netrin 1 receptor
8	61853.ENSNLEP00000009264	0.903	Caspase 9, apoptosis-related cysteine peptidase
9	61853.ENSNLEP00000004803	0.899	V-akt murine thymoma viral oncogene homolog 3
10	61853.ENSNLEP00000018473	0.849	OCRL, inositol polyphosphate-5-phosphatase
11	61853.ENSNLEP00000024387	0.781	RAB5C, member RAS oncogene family
12	61853.ENSNLEP00000015604	0.759	Neurotrophic tyrosine kinase, receptor, type 1
13	61853.ENSNLEP00000010755	0.748	Follicle-stimulating hormone receptor
14	61853.ENSNLEP00000014241	0.747	Inositol polyphosphate-5-phosphatase, 75kDa
15	61853.ENSNLEP00000005357	0.745	RAB21, member RAS oncogene family
16	61853.ENSNLEP00000009746	0.740	Discs, large homolog 4 (Drosophila)
17	61853.ENSNLEP00000021324	0.730	RAB5B, member RAS oncogene family
18	61853.ENSNLEP00000016390	0.725	Uncharacterized protein
19	61853.ENSNLEP00000013444	0.712	ADP-ribosylation factor-like 15
20	61853.ENSNLEP00000014687	0.712	ADP-ribosylation factor 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0005543	0.967	phospholipid binding
GO:0035091	0.941	phosphatidylinositol binding
GO:0042802	0.892	identical protein binding
GO:0042803	0.764	protein homodimerization activity
GO:0019899	0.575	enzyme binding
GO:0001786	0.539	phosphatidylserine binding
GO:0044877	0.510	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0071495	0.973	cellular response to endogenous stimulus
GO:0009987	0.969	cellular process
GO:0048522	0.928	positive regulation of cellular process
GO:0030334	0.919	regulation of cell migration
GO:0019222	0.917	regulation of metabolic process
GO:0051179	0.909	localization
GO:0009893	0.857	positive regulation of metabolic process
GO:0048523	0.836	negative regulation of cellular process
GO:0032879	0.835	regulation of localization
GO:0032501	0.834	multicellular organismal process
GO:0051049	0.825	regulation of transport
GO:0051051	0.816	negative regulation of transport
GO:0032502	0.810	developmental process
GO:0048856	0.798	anatomical structure development
GO:0060255	0.798	regulation of macromolecule metabolic process
GO:0051716	0.797	cellular response to stimulus
GO:0070848	0.783	response to growth factor
GO:0007275	0.770	multicellular organism development
GO:0009966	0.769	regulation of signal transduction
GO:0009889	0.765	regulation of biosynthetic process
GO:0042221	0.763	response to chemical
GO:0031323	0.759	regulation of cellular metabolic process
GO:0010468	0.753	regulation of gene expression
GO:0071840	0.738	cellular component organization or biogenesis
GO:0007154	0.736	cell communication
GO:0023052	0.709	signaling
GO:0051234	0.708	establishment of localization
GO:0007165	0.697	signal transduction
GO:0006810	0.694	transport
GO:0048731	0.685	system development
GO:0010762	0.676	regulation of fibroblast migration
GO:0016043	0.668	cellular component organization
GO:0051641	0.655	cellular localization
GO:0046324	0.653	regulation of glucose import
GO:0070887	0.634	cellular response to chemical stimulus
GO:0071310	0.577	cellular response to organic substance
GO:0007166	0.577	cell surface receptor signaling pathway
GO:0060627	0.571	regulation of vesicle-mediated transport
GO:0071363	0.525	cellular response to growth factor stimulus
GO:0007399	0.498	nervous system development
GO:0051050	0.470	positive regulation of transport
GO:0051171	0.449	regulation of nitrogen compound metabolic process
GO:0080090	0.441	regulation of primary metabolic process
GO:0031325	0.437	positive regulation of cellular metabolic process
GO:1901698	0.416	response to nitrogen compound
GO:0046907	0.411	intracellular transport
GO:0010604	0.400	positive regulation of macromolecule metabolic process
GO:0033036	0.394	macromolecule localization
GO:1901700	0.379	response to oxygen-containing compound
GO:0007167	0.362	enzyme-linked receptor protein signaling pathway
GO:1901701	0.355	cellular response to oxygen-containing compound
GO:0010243	0.354	response to organonitrogen compound
GO:0031326	0.353	regulation of cellular biosynthetic process
GO:0032870	0.334	cellular response to hormone stimulus
GO:0008152	0.332	metabolic process
GO:0071417	0.323	cellular response to organonitrogen compound
GO:0051128	0.322	regulation of cellular component organization
GO:0050764	0.308	regulation of phagocytosis
GO:0051239	0.301	regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005768	0.998	endosome
GO:0005769	0.994	early endosome
GO:0016020	0.984	membrane
GO:0071944	0.980	cell periphery
GO:0005886	0.973	plasma membrane
GO:0030054	0.949	cell junction
GO:0005576	0.947	extracellular region
GO:0005829	0.908	cytosol
GO:0005615	0.880	extracellular space
GO:0045202	0.879	synapse
GO:0043230	0.876	extracellular organelle
GO:0065010	0.866	extracellular membrane-bounded organelle
GO:0031090	0.857	organelle membrane
GO:1903561	0.842	extracellular vesicle
GO:0012506	0.835	vesicle membrane
GO:0070062	0.824	extracellular exosome
GO:0098588	0.819	bounding membrane of organelle
GO:0030659	0.793	cytoplasmic vesicle membrane
GO:0005634	0.660	nucleus
GO:0098794	0.508	postsynapse
GO:0010008	0.473	endosome membrane
GO:0120025	0.471	plasma membrane bounded cell projection
GO:0032991	0.461	protein-containing complex
GO:0043232	0.377	intracellular non-membrane-bounded organelle
GO:0070013	0.356	intracellular organelle lumen
GO:0031981	0.354	nuclear lumen
GO:0098793	0.334	presynapse
GO:0005654	0.318	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]