StarFunc result for job id Q9UKI8

User Input

>input (766 residues)
MSVQSSSGSLEGPPSWSQLSTSPTPGSAAAARSLLNHTPPSGRPREGAMDELHSLDPRRQ
ELLEARFTGVASGSTGSTGSCSVGAKASTNNESSNHSFGSLGSLSDKESETPEKKQSESS
RGRKRKAENQNESSQGKSIGGRGHKISDYFEYQGGNGSSPVRGIPPAIRSPQNSHSHSTP
SSSVRPNSPSPTALAFGDHPIVQPKQLSFKIIQTDLTMLKLAALESNKIQDLEKKEGRID
DLLRANCDLRRQIDEQQKLLEKYKERLNKCISMSKKLLIEKSTQEKLSSREKSMQDRLRL
GHFTTVRHGASFTEQWTDGFAFQNLVKQQEWVNQQREDIERQRKLLAKRKPPTANNSQAP
STNSEPKQRKNKAVNGAENDPFVRPNLPQLLTLAEYHEQEEIFKLRLGHLKKEEAEIQAE
LERLERVRNLHIRELKRINNEDNSQFKDHPTLNERYLLLHLLGRGGFSEVYKAFDLYEQR
YAAVKIHQLNKSWRDEKKENYHKHACREYRIHKELDHPRIVKLYDYFSLDTDTFCTVLEY
CEGNDLDFYLKQHKLMSEKEARSIVMQIVNALRYLNEIKPPIIHYDLKPGNILLVDGTAC
GEIKITDFGLSKIMDDDSYGVDGMDLTSQGAGTYWYLPPECFVVGKEPPKISNKVDVWSV
GVIFFQCLYGRKPFGHNQSQQDILQENTILKATEVQFPVKPVVSSEAKAFIRRCLAYRKE
DRFDVHQLANDPYLLPHMRRSNSSGNLHMAGLTASPTPPSSSIITY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UKI8	1.000	1.000	0.000	766	1.000	1.000	Q9UKI8.pdb.gz	TLK1_HUMAN Serine/threonine-protein kinase tousled-like 1 OS=Homo sapiens OX=9606 GN=TLK1 PE=1 SV=2
2	AFDB:M9PDQ2	0.456	0.349	6.555E-49	1011	0.385	0.292	M9PDQ2.pdb.gz	M9PDQ2_DROME Tousled-like kinase, isoform L OS=Drosophila melanogaster OX=7227 GN=Tlk PE=1 SV=1
3	AFDB:Q8I4W3	0.310	0.323	5.935E-19	735	0.174	0.181	Q8I4W3.pdb.gz	Q8I4W3_PLAF7 RAC-beta serine/threonine protein kinase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1246900 PE=4 SV=1
4	PDB:5u6yA	0.313	0.509	1.099E-18	459	0.103	0.172	5u6yA.pdb.gz
5	PDB:7myjC	0.305	0.490	1.687E-17	465	0.099	0.163	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
6	PDB:6b1uA	0.315	0.532	3.384E-17	442	0.101	0.174	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
7	PDB:1unlA	0.297	0.741	4.193E-17	292	0.091	0.240	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
8	PDB:2yaaA	0.315	0.766	5.782E-17	300	0.106	0.270	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
9	AFDB:A1ZBL5	0.314	0.255	6.265E-17	951	0.167	0.135	A1ZBL5.pdb.gz	A1ZBL5_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=2
10	PDB:4zhxA	0.303	0.551	6.435E-17	409	0.097	0.181	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
11	PDB:4c0tA	0.308	0.754	1.599E-16	291	0.091	0.241	4c0tA.pdb.gz
12	AFDB:Q8CEE6	0.309	0.177	1.643E-16	1383	0.179	0.099	Q8CEE6.pdb.gz	PASK_MOUSE PAS domain-containing serine/threonine-protein kinase OS=Mus musculus OX=10090 GN=Pask PE=1 SV=3
13	PDB:4eomC	0.310	0.809	1.687E-16	276	0.091	0.254	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
14	PDB:4rerA	0.318	0.519	1.687E-16	459	0.099	0.166	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
15	AFDB:Q9HFF4	0.307	0.234	1.828E-16	1023	0.174	0.130	Q9HFF4.pdb.gz	PPK1_SCHPO Serine/threonine-protein kinase ppk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk1 PE=1 SV=2
16	PDB:4krcA	0.302	0.735	2.206E-16	297	0.086	0.222	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
17	AFDB:F4J6F6	0.282	0.171	1.257E-15	1296	0.174	0.103	F4J6F6.pdb.gz	IREH1_ARATH Probable serine/threonine protein kinase IREH1 OS=Arabidopsis thaliana OX=3702 GN=IREH1 PE=1 SV=1
18	AFDB:Q5I6E9	0.300	0.327	1.399E-15	700	0.168	0.184	Q5I6E9.pdb.gz	Q5I6E9_SOLLC AvrPto-dependent Pto-interacting protein 3 OS=Solanum lycopersicum OX=4081 GN=Adi3 PE=1 SV=1
19	AFDB:F4HYG2	0.302	0.190	1.643E-15	1235	0.174	0.108	F4HYG2.pdb.gz	IRE3_ARATH Probable serine/threonine protein kinase IRE3 OS=Arabidopsis thaliana OX=3702 GN=IRE3 PE=2 SV=1
20	AFDB:P53739	0.306	0.264	2.036E-15	893	0.158	0.135	P53739.pdb.gz	FPK1_YEAST Flippase kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FPK1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O55047	0.0	1036	718	0.709	0.756	TLK2_MOUSE Serine/threonine-protein kinase tousled-like 2 OS=Mus musculus OX=10090 GN=Tlk2 PE=1 SV=2
2	Q86UE8	0.0	1048	772	0.722	0.716	TLK2_HUMAN Serine/threonine-protein kinase tousled-like 2 OS=Homo sapiens OX=9606 GN=TLK2 PE=1 SV=2
3	Q9UKI8	0.0	1595	766	1.000	1.000	TLK1_HUMAN Serine/threonine-protein kinase tousled-like 1 OS=Homo sapiens OX=9606 GN=TLK1 PE=1 SV=2
4	Q1RL19	5.45e-180	551	1255	0.341	0.208	Q1RL19_DROME LD15160p OS=Drosophila melanogaster OX=7227 GN=Tlk PE=1 SV=1
5	B7Z120	5.75e-180	550	1242	0.341	0.210	B7Z120_DROME Tousled-like kinase, isoform I OS=Drosophila melanogaster OX=7227 GN=Tlk PE=1 SV=1
6	M9PIZ6	5.95e-180	551	1265	0.341	0.206	M9PIZ6_DROME Tousled-like kinase, isoform K OS=Drosophila melanogaster OX=7227 GN=Tlk PE=1 SV=1
7	Q8IRT7	6.95e-180	550	1254	0.341	0.208	Q8IRT7_DROME Tousled-like kinase, isoform C OS=Drosophila melanogaster OX=7227 GN=Tlk PE=1 SV=4
8	Q9W4Q4	9.02e-180	550	1266	0.341	0.206	Q9W4Q4_DROME BcDNA.GH07910 OS=Drosophila melanogaster OX=7227 GN=Tlk PE=1 SV=2
9	B7Z126	3.94e-178	551	1489	0.341	0.175	B7Z126_DROME Tousled-like kinase, isoform G OS=Drosophila melanogaster OX=7227 GN=Tlk PE=1 SV=1
10	G3MTX3	1.05e-177	534	884	0.367	0.318	G3MTX3_CAEEL Protein kinase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tlk-1 PE=1 SV=1
11	P34314	1.68e-177	536	965	0.367	0.291	TLK1_CAEEL Serine/threonine-protein kinase tousled-like 1 OS=Caenorhabditis elegans OX=6239 GN=tlk-1 PE=1 SV=3
12	Q8IRT8	2.43e-177	549	1463	0.341	0.178	Q8IRT8_DROME Tousled-like kinase, isoform B OS=Drosophila melanogaster OX=7227 GN=Tlk PE=1 SV=3
13	Q2XN10	2.70e-177	533	893	0.362	0.310	Q2XN10_CAEEL Protein kinase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tlk-1 PE=1 SV=1
14	M9PDQ2	1.98e-157	485	1011	0.303	0.229	M9PDQ2_DROME Tousled-like kinase, isoform L OS=Drosophila melanogaster OX=7227 GN=Tlk PE=1 SV=1
15	Q39238	9.92e-144	439	688	0.304	0.339	TSL_ARATH Serine/threonine-protein kinase TOUSLED OS=Arabidopsis thaliana OX=3702 GN=TOUSLED PE=1 SV=1
16	Q57YS8	2.62e-105	338	650	0.251	0.295	Q57YS8_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10K10.520 PE=4 SV=1
17	Q584I8	1.42e-103	333	647	0.257	0.304	Q584I8_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3M17.710 PE=4 SV=1
18	C9JWT6	1.18e-76	246	162	0.166	0.784	C9JWT6_HUMAN Tousled like kinase 1 (Fragment) OS=Homo sapiens OX=9606 GN=TLK1 PE=1 SV=1
19	A0A509AQE6	3.47e-29	125	562	0.125	0.171	CDPK5_PLABA Calcium-dependent protein kinase 5 OS=Plasmodium berghei (strain Anka) OX=5823 GN=CDPK5 PE=1 SV=1
20	Q9VHF6	8.52e-29	123	520	0.107	0.158	Q9VHF6_DROME Serine/threonine-protein kinase ULK3 OS=Drosophila melanogaster OX=7227 GN=Aduk PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00069 Pkinase	2.2e-58	209.3	Protein kinase domain
2	PF07714 PK_Tyr_Ser-Thr	1e-30	118.5	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 27679.XP_010350545.1

Rank	PPI partner	STRING score	Description
1	27679.XP_003938667.1	0.920	Histone chaperone ASF1A
2	27679.XP_003941749.1	0.883	Histone chaperone ASF1B
3	27679.XP_010328628.1	0.811	Serine/threonine-protein kinase tousled-like 2
4	27679.XP_003920739.1	0.779	Probable ATP-dependent RNA helicase YTHDC2
5	27679.XP_010346437.1	0.749	Tyrosine-protein kinase JAK1
6	27679.XP_003941255.1	0.717	Cell cycle checkpoint control protein RAD9A isoform X1
7	27679.XP_003937565.1	0.702	Dyslexia-associated protein KIAA0319-like protein homolog isoform X1
8	27679.XP_003931068.1	0.637	NEDD4 family-interacting protein 2
9	27679.XP_003941195.1	0.632	Zinc finger protein 658
10	27679.XP_003920751.1	0.630	Band 4.1-like protein 4A isoform X1
11	27679.XP_003924019.1	0.585	Helicase POLQ-like isoform X1
12	27679.XP_010336313.1	0.579	Dyslexia-associated protein KIAA0319 homolog
13	27679.XP_003944394.1	0.546	Protein PRRC2A
14	27679.XP_010343893.1	0.530	Protein RCC2
15	27679.XP_010339687.1	0.526	Belongs to the HUS1 family.
16	27679.XP_010330214.1	0.500	Paternally-expressed gene 3 protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0005524	1.000	ATP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.998	cellular metabolic process
GO:0006807	0.997	nitrogen compound metabolic process
GO:0043170	0.997	macromolecule metabolic process
GO:0050794	0.995	regulation of cellular process
GO:0044238	0.994	primary metabolic process
GO:0050896	0.978	response to stimulus
GO:1901564	0.973	organonitrogen compound metabolic process
GO:0006793	0.947	phosphorus metabolic process
GO:0019538	0.907	protein metabolic process
GO:0016310	0.906	phosphorylation
GO:0006468	0.892	protein phosphorylation
GO:0051716	0.882	cellular response to stimulus
GO:0007154	0.718	cell communication
GO:0019222	0.718	regulation of metabolic process
GO:0035556	0.707	intracellular signal transduction
GO:1902275	0.686	regulation of chromatin organization
GO:0060255	0.476	regulation of macromolecule metabolic process
GO:0080090	0.453	regulation of primary metabolic process
GO:0051171	0.452	regulation of nitrogen compound metabolic process
GO:0048519	0.451	negative regulation of biological process
GO:0031323	0.430	regulation of cellular metabolic process
GO:0048523	0.399	negative regulation of cellular process
GO:0006950	0.398	response to stress
GO:0048518	0.381	positive regulation of biological process
GO:0033554	0.365	cellular response to stress
GO:0051179	0.349	localization
GO:0048522	0.306	positive regulation of cellular process
GO:0071840	0.302	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043232	0.989	intracellular non-membrane-bounded organelle
GO:0005737	0.961	cytoplasm
GO:0032991	0.326	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]