StarFunc result for job id Q9UKI9

User Input

>input (436 residues)
MVNLESMHTDIKMSGDVADSTDARSTLSQVEPGNDRNGLDFNRQIKTEDLSDSLQQTLSH
RPCHLSQGPAMMSGNQMSGLNASPCQDMASLHPLQQLVLVPGHLQSVSQFLLSQTQPGQQ
GLQPNLLPFPQQQSGLLLPQTGPGLASQAFGHPGLPGSSLEPHLEASQHLPVPKHLPSSG
GADEPSDLEELEKFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFK
NMCKLKPLLEKWLNDAESSPSDPSVSTPSSYPSLSEVFGRKRKKRTSIETNIRLTLEKRF
QDNPKPSSEEISMIAEQLSMEKEVVRVWFCNRRQKEKRINCPVATPIKPPVYNSRLVSPS
GSLGPLSVPPVHSTMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAVNSASSF
NSSGSWYRWNHSTYLH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UKI9	1.000	1.000	2.737E-54	436	1.000	1.000	Q9UKI9.pdb.gz	PO2F3_HUMAN POU domain, class 2, transcription factor 3 OS=Homo sapiens OX=9606 GN=POU2F3 PE=1 SV=3
2	AFDB:O13007	0.338	0.308	3.720E-24	480	0.484	0.440	O13007.pdb.gz	O13007_ICTPU POU domain protein OS=Ictalurus punctatus OX=7998 GN=Oct-2 PE=2 SV=1
3	AFDB:A0A0G2K3R5	0.345	0.316	1.138E-23	479	0.507	0.461	A0A0G2K3R5.pdb.gz	A0A0G2K3R5_RAT POU domain protein OS=Rattus norvegicus OX=10116 GN=Pou2f2 PE=1 SV=2
4	AFDB:B5ME60	0.340	0.257	1.865E-20	586	0.472	0.352	B5ME60.pdb.gz	B5ME60_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU2F2 PE=1 SV=4
5	AFDB:A7Y7W2	0.326	0.363	1.040E-16	389	0.317	0.355	A7Y7W2.pdb.gz	PO5F3_CHICK POU domain, class 5, transcription factor 3 OS=Gallus gallus OX=9031 GN=POU5F3 PE=1 SV=2
6	AFDB:A0A2R8Y739	0.329	0.393	1.097E-16	361	0.321	0.388	A0A2R8Y739.pdb.gz	A0A2R8Y739_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU3F4 PE=1 SV=1
7	AFDB:P20268	0.327	0.374	9.232E-16	380	0.296	0.339	P20268.pdb.gz	HM06_CAEEL Homeobox protein ceh-6 OS=Caenorhabditis elegans OX=6239 GN=ceh-6 PE=1 SV=3
8	AFDB:B7ZQA9	0.333	0.327	2.164E-15	445	0.298	0.292	B7ZQA9.pdb.gz	P5F12_XENLA POU domain, class 5, transcription factor 1.2 OS=Xenopus laevis OX=8355 GN=pou5f1.2 PE=1 SV=1
9	AFDB:Q9VK71	0.335	0.169	3.023E-12	893	0.378	0.185	Q9VK71.pdb.gz	PDM2B_DROME POU domain protein 2, isoform B OS=Drosophila melanogaster OX=7227 GN=pdm2 PE=2 SV=2
10	PDB:6t90K	0.153	0.896	5.424E-6	73	0.106	0.630	6t90K.pdb.gz	Mechanisms of OCT4-SOX2 motif readout on nucleosomes.
11	AFDB:O08755	0.203	0.193	5.823E-5	465	0.165	0.155	O08755.pdb.gz	HNF6_MOUSE Hepatocyte nuclear factor 6 OS=Mus musculus OX=10090 GN=Onecut1 PE=1 SV=1
12	PDB:4egcA	0.114	0.093	3.743E-2	539	0.085	0.069	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
13	PDB:3dnvB	0.111	0.569	1.495E-1	71	0.039	0.239	3dnvB.pdb.gz	Molecular mechanisms of HipA-mediated multidrug tolerance and its neutralization by HipB.
14	PDB:6dv9F	0.067	0.154	3.897E-1	174	0.048	0.121	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.
15	PDB:7fbyA	0.099	0.251	4.110E-1	153	0.032	0.092	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
16	PDB:2hi3A	0.122	0.654	5.967E-1	73	0.032	0.192	2hi3A.pdb.gz
17	PDB:4h63H	0.079	0.143	7.001E-1	174	0.060	0.149	4h63H.pdb.gz
18	PDB:1b0nA	0.096	0.354	1.016	103	0.032	0.136	1b0nA.pdb.gz	An evolutionary link between sporulation and prophage induction in the structure of a repressor:anti-repressor complex.
19	PDB:4j1xC	0.100	0.198	1.192	195	0.028	0.062	4j1xC.pdb.gz	Mechanistic studies of an unprecedented enzyme-catalysed 1,2-phosphono-migration reaction.
20	PDB:3f51A	0.111	0.426	1.475	94	0.025	0.117	3f51A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P31362	0.0	786	431	0.917	0.928	PO2F3_MOUSE POU domain, class 2, transcription factor 3 OS=Mus musculus OX=10090 GN=Pou2f3 PE=2 SV=3
2	P42571	0.0	781	430	0.908	0.921	PO2F3_RAT POU domain, class 2, transcription factor 3 OS=Rattus norvegicus OX=10116 GN=Pou2f3 PE=2 SV=2
3	Q9UKI9	0.0	890	436	1.000	1.000	PO2F3_HUMAN POU domain, class 2, transcription factor 3 OS=Homo sapiens OX=9606 GN=POU2F3 PE=1 SV=3
4	P09086	8.48e-101	310	479	0.440	0.401	PO2F2_HUMAN POU domain, class 2, transcription factor 2 OS=Homo sapiens OX=9606 GN=POU2F2 PE=1 SV=3
5	A0A8I6A6L7	1.97e-100	310	489	0.440	0.393	A0A8I6A6L7_RAT POU domain protein OS=Rattus norvegicus OX=10116 GN=Pou2f2 PE=3 SV=1
6	A0A8I5ZSA9	2.12e-98	303	440	0.399	0.395	A0A8I5ZSA9_RAT POU domain protein OS=Rattus norvegicus OX=10116 GN=Pou2f2 PE=3 SV=1
7	Q00196	6.16e-96	297	463	0.427	0.402	PO2F2_MOUSE POU domain, class 2, transcription factor 2 OS=Mus musculus OX=10090 GN=Pou2f2 PE=2 SV=4
8	A0A8I6A150	1.61e-95	302	661	0.399	0.263	A0A8I6A150_RAT POU domain protein OS=Rattus norvegicus OX=10116 GN=Pou2f2 PE=3 SV=1
9	A0A0G2KAN4	2.65e-95	298	547	0.431	0.344	A0A0G2KAN4_RAT POU domain protein OS=Rattus norvegicus OX=10116 GN=Pou2f2 PE=1 SV=2
10	A0A0G2K3R5	4.50e-95	300	606	0.427	0.307	A0A0G2K3R5_RAT POU domain protein OS=Rattus norvegicus OX=10116 GN=Pou2f2 PE=1 SV=2
11	B5ME60	5.57e-95	299	586	0.424	0.316	B5ME60_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU2F2 PE=1 SV=4
12	H0YLL6	5.66e-95	296	485	0.424	0.381	H0YLL6_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU2F2 PE=1 SV=1
13	H0YKT2	1.96e-93	296	618	0.424	0.299	H0YKT2_HUMAN POU domain protein (Fragment) OS=Homo sapiens OX=9606 GN=POU2F2 PE=1 SV=2
14	H0YNW1	2.06e-93	290	424	0.383	0.394	H0YNW1_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU2F2 PE=1 SV=1
15	O13007	1.03e-88	280	480	0.475	0.431	O13007_ICTPU POU domain protein OS=Ictalurus punctatus OX=7998 GN=Oct-2 PE=2 SV=1
16	H0YLC5	1.47e-86	263	160	0.344	0.938	H0YLC5_HUMAN POU class 2 homeobox 3 (Fragment) OS=Homo sapiens OX=9606 GN=POU2F3 PE=1 SV=9
17	Q29076	6.98e-86	279	745	0.378	0.221	PO2F1_PIG POU domain, class 2, transcription factor 1 OS=Sus scrofa OX=9823 GN=POU2F1 PE=2 SV=1
18	P16143	3.27e-84	275	758	0.376	0.216	PO2F1_XENLA POU domain, class 2, transcription factor 1 OS=Xenopus laevis OX=8355 GN=pou2f1 PE=1 SV=3
19	P31503	3.71e-84	272	632	0.353	0.244	PO2F1_RAT POU domain, class 2, transcription factor 1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Pou2f1 PE=1 SV=2
20	O57602	6.14e-84	271	623	0.388	0.271	O57602_ICTPU POU domain protein OS=Ictalurus punctatus OX=7998 GN=Oct1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14415 DUF4424	3.4e+02	11.9	Domain of unknown function (DUF4424)
2	PF05920 Homeobox_KN	65	14.9	Homeobox KN domain
3	PF00046 Homeodomain	3.7e-15	66.8	Homeodomain
4	PF00157 Pou	4.1e-33	124.5	Pou domain - N-terminal to homeobox domain
5	PF10263 SprT-like	3.7e+02	12.4	SprT-like family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000009026

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000017991	0.806	POU domain protein
2	61853.ENSNLEP00000024257	0.677	DDB1 and CUL4 associated factor 11
3	61853.ENSNLEP00000009038	0.622	Brain-specific homeobox
4	61853.ENSNLEP00000015363	0.618	DDHD domain containing 1
5	61853.ENSNLEP00000021542	0.609	Keratin 71
6	61853.ENSNLEP00000007886	0.574	Lipase, member H
7	61853.ENSNLEP00000014064	0.574	Lipase, endothelial
8	61853.ENSNLEP00000005694	0.566	Belongs to the integrin beta chain family.
9	61853.ENSNLEP00000005512	0.559	HRAS-like suppressor 2
10	61853.ENSNLEP00000005529	0.559	Phospholipase A2, group XVI
11	61853.ENSNLEP00000012486	0.559	Tuftelin 1
12	61853.ENSNLEP00000006061	0.549	Phospholipase A1 member A
13	61853.ENSNLEP00000021975	0.546	E74-like factor 3 (ets domain transcription factor, epithelial-specific )
14	61853.ENSNLEP00000003303	0.531	Transient receptor potential cation channel, subfamily M, member 5
15	61853.ENSNLEP00000022027	0.523	Zinc finger E-box binding homeobox 1
16	61853.ENSNLEP00000002856	0.522	Hedgehog acyltransferase
17	61853.ENSNLEP00000008789	0.514	BRCA1 associated RING domain 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0000981	0.996	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.995	transcription cis-regulatory region binding
GO:0001228	0.978	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	0.978	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0009889	0.985	regulation of biosynthetic process
GO:0051252	0.985	regulation of RNA metabolic process
GO:0006355	0.980	regulation of DNA-templated transcription
GO:0009987	0.958	cellular process
GO:0032502	0.944	developmental process
GO:0048518	0.931	positive regulation of biological process
GO:0048856	0.924	anatomical structure development
GO:0048522	0.902	positive regulation of cellular process
GO:0008544	0.887	epidermis development
GO:0010604	0.565	positive regulation of macromolecule metabolic process
GO:0051173	0.546	positive regulation of nitrogen compound metabolic process
GO:0032501	0.325	multicellular organismal process
GO:0030154	0.322	cell differentiation
GO:0048513	0.312	animal organ development
GO:1902680	0.305	positive regulation of RNA biosynthetic process
GO:0045893	0.304	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0031981	0.817	nuclear lumen
GO:0005737	0.808	cytoplasm
GO:0005654	0.702	nucleoplasm
GO:0016604	0.383	nuclear body
GO:0005730	0.363	nucleolus
GO:0032991	0.354	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]