StarFunc result for job id Q9UKJ3

User Input

>input (1502 residues)
MADRFSRFNEDRDFQGNHFDQYEEGHLEIEQASLDKPIESDNIGHRLLQKHGWKLGQGLG
KSLQGRTDPIPIVVKYDVMGMGRMEMELDYAEDATERRRVLEVEKEDTEELRQKYKDYVD
KEKAIAKALEDLRANFYCELCDKQYQKHQEFDNHINSYDHAHKQRLKDLKQREFARNVSS
RSRKDEKKQEKALRRLHELAEQRKQAECAPGSGPMFKPTTVAVDEEGGEDDKDESATNSG
TGATASCGLGSEFSTDKGGPFTAVQITNTTGLAQAPGLASQGISFGIKNNLGTPLQKLGV
SFSFAKKAPVKLESIASVFKDHAEEGTSEDGTKPDEKSSDQGLQKVGDSDGSSNLDGKKE
DEDPQDGGSLASTLSKLKRMKREEGAGATEPEYYHYIPPAHCKVKPNFPFLLFMRASEQM
DGDNTTHPKNAPESKKGSSPKPKSCIKAAASQGAEKTVSEVSEQPKETSMTEPSEPGSKA
EAKKALGGDVSDQSLESHSQKVSETQMCESNSSKETSLATPAGKESQEGPKHPTGPFFPV
LSKDESTALQWPSELLIFTKAEPSISYSCNPLYFDFKLSRNKDARTKGTEKPKDIGSSSK
DHLQGLDPGEPNKSKEVGGEKIVRSSGGRMDAPASGSACSGLNKQEPGGSHGSETEDTGR
SLPSKKERSGKSHRHKKKKKHKKSSKHKRKHKADTEEKSSKAESGEKSKKRKKRKRKKNK
SSAPADSERGPKPEPPGSGSPAPPRRRRRAQDDSQRRSLPAEEGSSGKKDEGGGGSSSQD
HGGRKHKGELPPSSCQRRAGTKRSSRSSHRSQPSSGDEDSDDASSHRLHQKSPSQYSEEE
EEEDSGSEHSRSRSRSGRRHSSHRSSRRSYSSSSDASSDQSCYSRQRSYSDDSYSDYSDR
SRRHSKRSHDSDDSDYASSKHRSKRHKYSSSDDDYSLSCSQSRSRSRSHTRERSRSRGRS
RSSSCSRSRSKRRSRSTTAHSWQRSRSYSRDRSRSTRSPSQRSGSRKRSWGHESPEERHS
GRRDFIRSKIYRSQSPHYFRSGRGEGPGKKDDGRGDDSKATGPPSQNSNIGTGRGSEGDC
SPEDKNSVTAKLLLEKIQSRKVERKPSVSEEVQATPNKAGPKLKDPPQGYFGPKLPPSLG
NKPVLPLIGKLPATRKPNKKCEESGLERGEEQEQSETEEGPPGSSDALFGHQFPSEETTG
PLLDPPPEESKSGEATADHPVAPLGTPAHSDCYPGDPTISHNYLPDPSDGDTLESLDSSS
QPGPVESSLLPIAPDLEHFPSYAPPSGDPSIESTDGAEDASLAPLESQPITFTPEEMEKY
SKLQQAAQQHIQQQLLAKQVKAFPASAALAPATPALQPIHIQQPATASATSITTVQHAIL
QHHAAAAAAAIGIHPHPHPQPLAQVHHIPQPHLTPISLSHLTHSIIPGHPATFLASHPIH
IIPASAIHPGPFTFHPVPHAALYPTLLAPRPAAAAATALHLHPLLHPIFSGQDLQHPPSH
GT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2A6A1	0.285	0.284	0.000	1505	0.903	0.902	A2A6A1.pdb.gz	GPTC8_MOUSE G patch domain-containing protein 8 OS=Mus musculus OX=10090 GN=Gpatch8 PE=1 SV=1
2	AFDB:Q7Z570	0.065	0.080	6.723E-27	1209	0.222	0.276	Q7Z570.pdb.gz	Z804A_HUMAN Zinc finger protein 804A OS=Homo sapiens OX=9606 GN=ZNF804A PE=2 SV=3
3	AFDB:B1AR09	0.032	0.043	5.456E-5	1079	0.114	0.158	B1AR09.pdb.gz	B1AR09_MOUSE Myeloid/lymphoid or mixed-lineage leukemia; translocated to, 6 OS=Mus musculus OX=10090 GN=Mllt6 PE=1 SV=1
4	AFDB:A0A0R4INF0	0.027	0.024	7.423E-4	1570	0.149	0.143	A0A0R4INF0.pdb.gz	A0A0R4INF0_DANRE Zinc finger and BTB domain-containing 4 OS=Danio rerio OX=7955 GN=zbtb4 PE=4 SV=1
5	AFDB:Q7KMH9	0.032	0.035	9.029E-4	1420	0.128	0.136	Q7KMH9.pdb.gz	Q7KMH9_DROME BcDNA.LD26050 OS=Drosophila melanogaster OX=7227 GN=wde PE=1 SV=1
6	AFDB:D4A7V6	0.046	0.039	3.120E-3	1962	0.171	0.131	D4A7V6.pdb.gz	D4A7V6_RAT Caspase 8 associated protein 2 OS=Rattus norvegicus OX=10116 GN=Casp8ap2 PE=1 SV=1
7	AFDB:F8W451	0.035	0.045	3.120E-3	1133	0.103	0.137	F8W451.pdb.gz	F8W451_DANRE MLLT10 histone lysine methyltransferase DOT1L cofactor OS=Danio rerio OX=7955 GN=mllt10 PE=4 SV=1
8	AFDB:A0A2R8RZV0	0.040	0.056	3.795E-3	1059	0.099	0.140	A0A2R8RZV0.pdb.gz
9	AFDB:Q552E2	0.034	0.034	6.828E-3	1479	0.148	0.151	Q552E2.pdb.gz	WASC2_DICDI WASH complex subunit 2 OS=Dictyostelium discoideum OX=44689 GN=washc2 PE=1 SV=1
10	AFDB:Q9VQI9	0.036	0.033	1.151E-2	1673	0.134	0.121	Q9VQI9.pdb.gz	AFFL_DROME AF4/FMR2 family member lilli OS=Drosophila melanogaster OX=7227 GN=lilli PE=1 SV=2
11	PDB:7mqaSS	0.031	0.097	1.258	350	0.019	0.083	7mqaSS.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:6qx91C	0.027	0.535	2.120	50	0.007	0.220	6qx91C.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
13	PDB:1ho5A	0.018	0.043	3.814	525	0.003	0.010	1ho5A.pdb.gz	Mechanism of hydrolysis of phosphate esters by the dimetal center of 5'-nucleotidase based on crystal structures.
14	PDB:7v2wJ	0.034	0.152	4.639	236	0.012	0.076	7v2wJ.pdb.gz
15	PDB:5nrlU	0.023	0.169	7.325	196	0.003	0.026	5nrlU.pdb.gz	Structure of a pre-catalytic spliceosome.
16	PDB:6g90U	0.026	0.194	7.819	196	0.003	0.026	6g90U.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2A6A1	0.0	2106	1505	0.903	0.902	GPTC8_MOUSE G patch domain-containing protein 8 OS=Mus musculus OX=10090 GN=Gpatch8 PE=1 SV=1
2	Q9UKJ3	0.0	3041	1502	1.000	1.000	GPTC8_HUMAN G patch domain-containing protein 8 OS=Homo sapiens OX=9606 GN=GPATCH8 PE=1 SV=2
3	Q7Z570	7.43e-56	216	1209	0.080	0.099	Z804A_HUMAN Zinc finger protein 804A OS=Homo sapiens OX=9606 GN=ZNF804A PE=2 SV=3
4	F1M078	1.73e-54	211	1198	0.080	0.100	F1M078_RAT Zinc finger protein 804A OS=Rattus norvegicus OX=10116 GN=Zfp804a PE=4 SV=4
5	Q147M4	5.91e-30	124	301	0.057	0.282	Q147M4_ARATH At5g26610 OS=Arabidopsis thaliana OX=3702 GN=At5g26610 PE=1 SV=1
6	Q9VPY4	1.04e-05	52.8	1004	0.016	0.024	Q9VPY4_DROME FI21118p1 OS=Drosophila melanogaster OX=7227 GN=Dmel\CG4887 PE=1 SV=1
7	Q8SZM4	1.05e-05	52.8	1004	0.016	0.024	Q8SZM4_DROME RH03791p OS=Drosophila melanogaster OX=7227 GN=CG4887 PE=2 SV=1
8	Q94C11	1.39e-05	52.0	443	0.015	0.052	SUGP1_ARATH SURP and G-patch domain-containing protein 1-like protein OS=Arabidopsis thaliana OX=3702 GN=At3g52120 PE=1 SV=1
9	P52756	2.97e-05	51.2	815	0.017	0.031	RBM5_HUMAN RNA-binding protein 5 OS=Homo sapiens OX=9606 GN=RBM5 PE=1 SV=2
10	Q08CK9	0.004	43.9	774	0.014	0.027	Q08CK9_DANRE Angiogenic factor with G patch and FHA domains 1 OS=Danio rerio OX=7955 GN=zgc:152959 PE=2 SV=1
11	Q9VHB0	0.013	42.7	874	0.014	0.024	SON_DROME Protein Son OS=Drosophila melanogaster OX=7227 GN=Son PE=1 SV=1
12	Q8N954	0.014	41.6	285	0.015	0.077	GPT11_HUMAN G patch domain-containing protein 11 OS=Homo sapiens OX=9606 GN=GPATCH11 PE=1 SV=4
13	H7C1M2	0.13	39.3	1454	0.011	0.011	H7C1M2_HUMAN SON DNA and RNA binding protein (Fragment) OS=Homo sapiens OX=9606 GN=SON PE=1 SV=1
14	P18583	0.21	38.9	2426	0.011	0.007	SON_HUMAN Protein SON OS=Homo sapiens OX=9606 GN=SON PE=1 SV=4
15	P53335	0.21	37.7	271	0.012	0.066	PXR1_YEAST Protein PXR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PXR1 PE=1 SV=1
16	Q9QX47	0.21	38.9	2444	0.011	0.007	SON_MOUSE Protein SON OS=Mus musculus OX=10090 GN=Son PE=1 SV=2
17	Q5T3I0	0.23	38.1	446	0.010	0.034	GPTC4_HUMAN G patch domain-containing protein 4 OS=Homo sapiens OX=9606 GN=GPATCH4 PE=1 SV=2
18	F4JCU0	0.26	38.5	1007	0.009	0.014	SUA_ARATH SUPPRESSOR OF ABI3-5 OS=Arabidopsis thaliana OX=3702 GN=SUA PE=1 SV=2
19	Q3TFK5	0.85	36.2	415	0.010	0.036	GPTC4_MOUSE G patch domain-containing protein 4 OS=Mus musculus OX=10090 GN=Gpatch4 PE=1 SV=1
20	Q96NC0	8.3	32.3	199	0.020	0.151	ZMAT2_HUMAN Zinc finger matrin-type protein 2 OS=Homo sapiens OX=9606 GN=ZMAT2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01585 G-patch	1.7e-09	48.7	G-patch domain
2	PF12656 G-patch_2	77	14.8	G-patch domain
3	PF11931 SF3a60_Prp9_C	5.9	18.8	SF3a60/Prp9 C-terminal
4	PF12171 zf-C2H2_jaz	0.003	29.1	Zinc-finger double-stranded RNA-binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000467556

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000392094	0.895	116 kDa U5 small nuclear ribonucleoprotein component
2	9606.ENSP00000261531	0.849	SNW domain-containing protein 1
3	9606.ENSP00000366557	0.842	Crooked neck-like protein 1
4	9606.ENSP00000262962	0.834	Part of the spliceosome which catalyzes two sequential transesterification reactions, first the excision of the non-coding intron from pre-mRNA and then the ligation of the coding exons to form the mature mRNA . Plays a role in stabilizing the structure of the spliceosome catalytic core and docking of the branch helix into the active site, producing 5'-exon and lariat intron-3'- intermediates (By similarity). May protect cells from TP53-dependent apoptosis upon dsDNA break damage through association with PRP19-CD5L complex
5	9606.ENSP00000351137	0.814	Pre-mRNA-splicing factor SYF1
6	9606.ENSP00000360532	0.806	Cell division cycle 5-like protein
7	9606.ENSP00000460348	0.797	Pre-mRNA-processing-splicing factor 8
8	9606.ENSP00000227524	0.784	Pre-mRNA-processing factor 19
9	9606.ENSP00000386023	0.780	Protein BUD31 homolog
10	9606.ENSP00000475615	0.775	Spliceosome-associated protein CWC15 homolog
11	9606.ENSP00000199814	0.773	Pre-mRNA-splicing factor RBM22
12	9606.ENSP00000346335	0.772	Protein NRDE2 homolog
13	9606.ENSP00000424417	0.761	Pleiotropic regulator 1
14	9606.ENSP00000254193	0.756	U2 small nuclear ribonucleoprotein A
15	9606.ENSP00000236273	0.753	Pre-mRNA-splicing factor SYF2
16	9606.ENSP00000272348	0.749	Small nuclear ribonucleoprotein G
17	9606.ENSP00000361577	0.748	Leucine-rich melanocyte differentiation-associated protein
18	9606.ENSP00000336741	0.744	Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15
19	9606.ENSP00000317123	0.741	U5 small nuclear ribonucleoprotein 200 kDa helicase
20	9606.ENSP00000284690	0.735	Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.945	biological regulation
GO:0050789	0.941	regulation of biological process
GO:0050794	0.914	regulation of cellular process
GO:0071704	0.897	organic substance metabolic process
GO:0009987	0.893	cellular process
GO:0044238	0.883	primary metabolic process
GO:0043170	0.847	macromolecule metabolic process
GO:0006807	0.821	nitrogen compound metabolic process
GO:0044237	0.819	cellular metabolic process
GO:0006139	0.737	nucleobase-containing compound metabolic process
GO:0090304	0.724	nucleic acid metabolic process
GO:0016070	0.710	RNA metabolic process
GO:0006396	0.596	RNA processing
GO:0048518	0.562	positive regulation of biological process
GO:0008380	0.513	RNA splicing
GO:0016071	0.469	mRNA metabolic process
GO:0006397	0.423	mRNA processing
GO:0019222	0.395	regulation of metabolic process
GO:0000398	0.393	mRNA splicing, via spliceosome
GO:0060255	0.368	regulation of macromolecule metabolic process
GO:0048522	0.307	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031974	0.996	membrane-enclosed lumen
GO:0070013	0.986	intracellular organelle lumen
GO:0031981	0.981	nuclear lumen
GO:0005654	0.974	nucleoplasm
GO:0032991	0.958	protein-containing complex
GO:1990904	0.861	ribonucleoprotein complex
GO:0140513	0.859	nuclear protein-containing complex
GO:0016604	0.636	nuclear body
GO:0016607	0.604	nuclear speck
GO:1902494	0.537	catalytic complex
GO:0005681	0.523	spliceosomal complex
GO:0005737	0.498	cytoplasm
GO:0043232	0.319	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]