StarFunc result for job id Q9UKK3

User Input

>input (1724 residues)
MVMGIFANCIFCLKVKYLPQQQKKKLQTDIKENGGKFSFSLNPQCTHIILDNADVLSQYQ
LNSIQKNHVHIANPDFIWKSIREKRLLDVKNYDPYKPLDITPPPDQKASSSEVKTEGLCP
DSATEEEDTVELTEFGMQNVEIPHLPQDFEVAKYNTLEKVGMEGGQEAVVVELQCSRDSR
DCPFLISSHFLLDDGMETRRQFAIKKTSEDASEYFENYIEELKKQGFLLREHFTPEATQL
ASEQLQALLLEEVMNSSTLSQEVSDLVEMIWAEALGHLEHMLLKPVNRISLNDVSKAEGI
LLLVKAALKNGETAEQLQKMMTEFYRLIPHKGTMPKEVNLGLLAKKADLCQLIRDMVNVC
ETNLSKPNPPSLAKYRALRCKIEHVEQNTEEFLRVRKEVLQNHHSKSPVDVLQIFRVGRV
NETTEFLSKLGNVRPLLHGSPVQNIVGILCRGLLLPKVVEDRGVQRTDVGNLGSGIYFSD
SLSTSIKYSHPGETDGTRLLLICDVALGKCMDLHEKDFSLTEAPPGYDSVHGVSQTASVT
TDFEDDEFVVYKTNQVKMKYIIKFSMPGDQIKDFHPSDHTELEEYRPEFSNFSKVEDYQL
PDAKTSSSTKAGLQDASGNLVPLEDVHIKGRIIDTVAQVIVFQTYTNKSHVPIEAKYIFP
LDDKAAVCGFEAFINGKHIVGEIKEKEEAQQEYLEAVTQGHGAYLMSQDAPDVFTVSVGN
LPPKAKVLIKITYITELSILGTVGVFFMPATVAPWQQDKALNENLQDTVEKICIKEIGTK
QSFSLTMSIEMPYVIEFIFSDTHELKQKRTDCKAVISTMEGSSLDSSGFSLHIGLSAAYL
PRMWVEKHPEKESEACMLVFQPDLDVDLPDLASESEVIICLDCSSSMEGVTFLQAKQIAL
HALSLVGEKQKVNIIQFGTGYKELFSYPKHITSNTMAAEFIMSATPTMGNTDFWKTLRYL
SLLYPARGSRNILLVSDGHLQDESLTLQLVKRSRPHTRLFACGIGSTANRHVLRILSQCG
AGVFEYFNAKSKHSWRKQIEDQMTRLCSPSCHSVSVKWQQLNPDVPEALQAPAQVPSLFL
NDRLLVYGFIPHCTQATLCALIQEKEFRTMVSTTELQKTTGTMIHKLAARALIRDYEDGI
LHENETSHEMKKQTLKSLIIKLSKENSLITQFTSFVAVEKRDENESPFPDIPKVSELIAK
EDVDFLPYMSWQGEPQEAVRNQSLLASSEWPELRLSKRKHRKIPFSKRKMELSQPEVSED
FEEDGLGVLPAFTSNLERGGVEKLLDLSWTESCKPTATEPLFKKVSPWETSTSSFFPILA
PAVGSYLPPTARAHSPASLSFASYRQVASFGSAAPPRQFDASQFSQGPVPGTCADWIPQS
ASCPTGPPQNPPSSPYCGIVFSGSSLSSAQSAPLQHPGGFTTRPSAGTFPELDSPQLHFS
LPTDPDPIRGFGSYHPSASSPFHFQPSAASLTANLRLPMASALPEALCSQSRTTPVDLCL
LEESVGSLEGSRCPVFAFQSSDTESDELSEVLQDSCFLQIKCDTKDDSILCFLEVKEEDE
IVCIQHWQDAVPWTELLSLQTEDGFWKLTPELGLILNLNTNGLHSFLKQKGIQSLGVKGR
ECLLDLIATMLVLQFIRTRLEKEGIVFKSLMKMDDASISRNIPWAFEAIKQASEWVRRTE
GQYPSICPRLELGNDWDSATKQLLGLQPISTVSPLHRVLHYSQG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PYK3	0.727	0.641	0.000	1969	0.671	0.587	E9PYK3.pdb.gz	PARP4_MOUSE Protein mono-ADP-ribosyltransferase PARP4 OS=Mus musculus OX=10090 GN=Parp4 PE=1 SV=1
2	AFDB:Q9UKK3	1.000	1.000	0.000	1724	1.000	1.000	Q9UKK3.pdb.gz	PARP4_HUMAN Protein mono-ADP-ribosyltransferase PARP4 OS=Homo sapiens OX=9606 GN=PARP4 PE=1 SV=3
3	PDB:6x0lP	0.148	0.451	1.872E-19	474	0.057	0.209	6x0lP.pdb.gz	Bridging of DNA breaks activates PARP2-HPF1 to modify chromatin.
4	PDB:1m2vA	0.121	0.252	1.660E-5	705	0.027	0.065	1m2vA.pdb.gz	Structure of the Sec23/24-Sar1 pre-budding complex of the COPII vesicle coat
5	AFDB:E9Q7P1	0.102	0.108	2.241E-5	1613	0.066	0.070	E9Q7P1.pdb.gz	E9Q7P1_MOUSE Collagen, type XXII, alpha 1 OS=Mus musculus OX=10090 GN=Col22a1 PE=1 SV=1
6	PDB:6zgaB	0.124	0.231	2.416E-5	786	0.024	0.052	6zgaB.pdb.gz	Structure of the complete, membrane-assembled COPII coat reveals a complex interaction network.
7	AFDB:Q8NFW1	0.103	0.109	3.756E-5	1626	0.064	0.068	Q8NFW1.pdb.gz	COMA1_HUMAN Collagen alpha-1(XXII) chain OS=Homo sapiens OX=9606 GN=COL22A1 PE=2 SV=2
8	PDB:6jp8F	0.100	0.171	5.121E-5	973	0.025	0.044	6jp8F.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
9	PDB:3b7rL	0.082	0.211	5.367E-5	610	0.020	0.057	3b7rL.pdb.gz	Structure-based dissection of the active site chemistry of leukotriene a4 hydrolase: implications for m1 aminopeptidases and inhibitor design.
10	PDB:3mdjC	0.086	0.168	7.456E-5	819	0.032	0.068	3mdjC.pdb.gz	Structural basis for antigenic peptide precursor processing by the endoplasmic reticulum aminopeptidase ERAP1.
11	PDB:7nxdB	0.099	0.213	1.138E-4	690	0.019	0.046	7nxdB.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
12	PDB:6ujaB	0.094	0.358	1.192E-4	359	0.021	0.100	6ujaB.pdb.gz	Cryo-EM Reveals Integrin-Mediated TGF-beta Activation without Release from Latent TGF-beta.
13	PDB:4wz9B	0.084	0.153	1.736E-4	887	0.035	0.068	4wz9B.pdb.gz	The Anopheles-midgut APN1 structure reveals a new malaria transmission-blocking vaccine epitope.
14	PDB:6rqxA	0.087	0.162	2.195E-4	862	0.032	0.065	6rqxA.pdb.gz	Mechanism for antigenic peptide selection by endoplasmic reticulum aminopeptidase 1.
15	AFDB:Q2M2H8	0.045	0.038	3.563E-2	2515	0.079	0.054	Q2M2H8.pdb.gz	MGAL_HUMAN Probable maltase-glucoamylase 2 OS=Homo sapiens OX=9606 GN=MGAM2 PE=2 SV=3
16	AFDB:Q0E9F2	0.037	0.041	3.914E-2	1542	0.071	0.080	Q0E9F2.pdb.gz	Q0E9F2_DROME Sticks and stones, isoform B OS=Drosophila melanogaster OX=7227 GN=sns PE=1 SV=1
17	AFDB:P00451	0.045	0.037	4.950E-2	2351	0.064	0.047	P00451.pdb.gz	FA8_HUMAN Coagulation factor VIII OS=Homo sapiens OX=9606 GN=F8 PE=1 SV=1
18	AFDB:Q9VS29	0.043	0.038	5.188E-2	2074	0.069	0.057	Q9VS29.pdb.gz	DSCL_DROME Cell adhesion molecule Dscam2 OS=Drosophila melanogaster OX=7227 GN=Dscam2 PE=2 SV=3
19	AFDB:Q4VA61	0.038	0.034	5.698E-2	2053	0.077	0.064	Q4VA61.pdb.gz	DSCL1_MOUSE Cell adhesion molecule DSCAML1 OS=Mus musculus OX=10090 GN=Dscaml1 PE=1 SV=2
20	AFDB:D3ZEB1	0.047	0.039	1.266E-1	2257	0.077	0.058	D3ZEB1.pdb.gz	D3ZEB1_RAT Coagulation factor VIII OS=Rattus norvegicus OX=10116 GN=F8 PE=3 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PYK3	0.0	1940	1969	0.554	0.485	PARP4_MOUSE Protein mono-ADP-ribosyltransferase PARP4 OS=Mus musculus OX=10090 GN=Parp4 PE=1 SV=1
2	Q9UKK3	0.0	3570	1724	1.000	1.000	PARP4_HUMAN Protein mono-ADP-ribosyltransferase PARP4 OS=Homo sapiens OX=9606 GN=PARP4 PE=1 SV=3
3	Q54LJ4	2.89e-154	528	2563	0.189	0.127	Q54LJ4_DICDI Poly [ADP-ribose] polymerase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0286613 PE=3 SV=1
4	Q99KC8	5.01e-43	172	793	0.094	0.204	VMA5A_MOUSE von Willebrand factor A domain-containing protein 5A OS=Mus musculus OX=10090 GN=Vwa5a PE=1 SV=2
5	Q54HY5	5.59e-43	175	1803	0.066	0.063	Q54HY5_DICDI Poly [ADP-ribose] polymerase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0289141 PE=3 SV=2
6	O00534	2.76e-39	160	786	0.092	0.201	VMA5A_HUMAN von Willebrand factor A domain-containing protein 5A OS=Homo sapiens OX=9606 GN=VWA5A PE=1 SV=2
7	Q55GU8	8.13e-38	154	644	0.088	0.234	Q55GU8_DICDI Poly [ADP-ribose] polymerase OS=Dictyostelium discoideum OX=44689 GN=adprt4 PE=4 SV=1
8	Q8C1D4	7.50e-35	147	804	0.091	0.195	Q8C1D4_MOUSE von Willebrand factor A domain-containing protein 5A OS=Mus musculus OX=10090 GN=AW551984 PE=2 SV=1
9	Q8BGF0	7.90e-35	147	804	0.091	0.195	Q8BGF0_MOUSE Expressed sequence AW551984 OS=Mus musculus OX=10090 GN=AW551984 PE=1 SV=1
10	B4DHS6	6.71e-25	112	431	0.061	0.246	B4DHS6_HUMAN cDNA FLJ55206, highly similar to Loss of heterozygosity 11 chromosomal region 2 gene A protein OS=Homo sapiens OX=9606 GN=VWA5A PE=1 SV=1
11	P26446	8.00e-25	115	1011	0.066	0.113	PARP1_CHICK Poly [ADP-ribose] polymerase 1 OS=Gallus gallus OX=9031 GN=PARP1 PE=1 SV=2
12	P09874	1.28e-23	111	1014	0.066	0.111	PARP1_HUMAN Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4
13	P27008	2.39e-23	110	1014	0.066	0.112	PARP1_RAT Poly [ADP-ribose] polymerase 1 OS=Rattus norvegicus OX=10116 GN=Parp1 PE=1 SV=4
14	D3Z518	1.63e-22	99.8	210	0.035	0.290	D3Z518_MOUSE Expressed sequence AW551984 (Fragment) OS=Mus musculus OX=10090 GN=AW551984 PE=1 SV=1
15	P11103	1.76e-22	107	1013	0.059	0.100	PARP1_MOUSE Poly [ADP-ribose] polymerase 1 OS=Mus musculus OX=10090 GN=Parp1 PE=1 SV=3
16	Q5RHR0	8.69e-22	105	1013	0.056	0.095	PARP1_DANRE Poly [ADP-ribose] polymerase 1 OS=Danio rerio OX=7955 GN=parp1 PE=2 SV=1
17	Q11207	1.95e-21	103	637	0.053	0.143	PARP2_ARATH Poly [ADP-ribose] polymerase 2 OS=Arabidopsis thaliana OX=3702 GN=PARP2 PE=2 SV=1
18	Q9UGN5	1.25e-20	100	583	0.048	0.142	PARP2_HUMAN Poly [ADP-ribose] polymerase 2 OS=Homo sapiens OX=9606 GN=PARP2 PE=1 SV=2
19	Q6P8K4	3.12e-20	100	763	0.035	0.080	Q6P8K4_MOUSE AW551984 protein OS=Mus musculus OX=10090 GN=AW551984 PE=2 SV=1
20	Q57ZY1	1.39e-19	97.4	573	0.055	0.164	Q57ZY1_TRYB2 Poly [ADP-ribose] polymerase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.26K5.30 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00533 BRCT	1.2e-08	46.5	BRCA1 C Terminus (BRCT) domain
2	PF16589 BRCT_2	4.4e-07	41.5	BRCT domain, a BRCA1 C-terminus domain
3	PF00644 PARP	9.1e-36	134.8	Poly(ADP-ribose) polymerase catalytic domain
4	PF02877 PARP_reg	0.042	25.4	Poly(ADP-ribose) polymerase, regulatory domain
5	PF12738 PTCB-BRCT	4.2	18.7	twin BRCT domain
6	PF08487 VIT	1.6e-39	145.9	Vault protein inter-alpha-trypsin domain
7	PF13757 VIT_2	6.2e-12	56.6	Vault protein inter-alpha-trypsin domain
8	PF00092 VWA	4.7e-10	51.5	von Willebrand factor type A domain
9	PF13519 VWA_2	0.00014	33.8	von Willebrand factor type A domain
10	PF13768 VWA_3	9.1e-09	46.9	von Willebrand factor type A domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371419

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378760	0.996	Major vault protein
2	9606.ENSP00000262715	0.961	Telomerase protein component 1
3	9606.ENSP00000384408	0.862	Poly(ADP-ribose) glycohydrolase
4	9606.ENSP00000311032	0.834	Caspase-3
5	9606.ENSP00000358327	0.822	Caspase-7
6	9606.ENSP00000330237	0.821	Caspase-9
7	9606.ENSP00000216341	0.800	Granzyme B
8	9606.ENSP00000325618	0.738	Poly [ADP-ribose] polymerase 10
9	9606.ENSP00000261888	0.709	Mono [ADP-ribose] polymerase PARP16
10	9606.ENSP00000456348	0.709	poly(ADP-ribose) polymerase family member 6
11	9606.ENSP00000417214	0.704	Poly [ADP-ribose] polymerase 15
12	9606.ENSP00000353512	0.685	Poly [ADP-ribose] polymerase 9
13	9606.ENSP00000418194	0.643	Poly [ADP-ribose] polymerase 14
14	9606.ENSP00000281631	0.637	poly(ADP-ribose) polymerase family member 8
15	9606.ENSP00000389445	0.635	Ubiquitin-associated protein 2-like
16	9606.ENSP00000263549	0.624	poly(ADP-ribose) polymerase family member 12
17	9606.ENSP00000330264	0.616	Transmembrane protease serine 9
18	9606.ENSP00000474071	0.613	Coiled-coil domain-containing protein 120
19	9606.ENSP00000242351	0.610	Zinc finger CCCH-type antiviral protein 1
20	9606.ENSP00000420612	0.605	TCDD-inducible poly [ADP-ribose] polymerase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	1.000	enzyme binding
GO:0003950	1.000	NAD+ ADP-ribosyltransferase activity
GO:0003677	1.000	DNA binding
GO:1990404	1.000	NAD+-protein ADP-ribosyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.992	response to stimulus
GO:0050794	0.986	regulation of cellular process
GO:0060255	0.986	regulation of macromolecule metabolic process
GO:0051171	0.986	regulation of nitrogen compound metabolic process
GO:0006259	0.985	DNA metabolic process
GO:0031323	0.983	regulation of cellular metabolic process
GO:0006974	0.982	cellular response to DNA damage stimulus
GO:0080090	0.981	regulation of primary metabolic process
GO:0019219	0.974	regulation of nucleobase-containing compound metabolic process
GO:0019538	0.960	protein metabolic process
GO:0043412	0.948	macromolecule modification
GO:0051052	0.932	regulation of DNA metabolic process
GO:0010556	0.929	regulation of macromolecule biosynthetic process
GO:0065009	0.924	regulation of molecular function
GO:0006281	0.920	DNA repair
GO:0031326	0.910	regulation of cellular biosynthetic process
GO:0008219	0.902	cell death
GO:0050790	0.833	regulation of catalytic activity
GO:0036211	0.785	protein modification process
GO:2000278	0.716	regulation of DNA biosynthetic process
GO:0051338	0.713	regulation of transferase activity
GO:0051972	0.655	regulation of telomerase activity
GO:0048518	0.489	positive regulation of biological process
GO:0048522	0.342	positive regulation of cellular process
GO:0006954	0.339	inflammatory response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005819	0.998	spindle
GO:0005654	0.997	nucleoplasm
GO:0005829	0.990	cytosol
GO:0016020	0.936	membrane
GO:0005576	0.886	extracellular region
GO:0070062	0.847	extracellular exosome
GO:0099080	0.636	supramolecular complex
GO:0005876	0.539	spindle microtubule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.2.30	1.000	NAD(+) ADP-ribosyltransferase.

[back to server]