StarFunc result for job id Q9UKK9

User Input

>input (219 residues)
MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTAD
GVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYK
GDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQ
RLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UKK9	1.000	1.000	8.769E-48	219	1.000	1.000	Q9UKK9.pdb.gz	NUDT5_HUMAN ADP-sugar pyrophosphatase OS=Homo sapiens OX=9606 GN=NUDT5 PE=1 SV=1
2	AFDB:Q9JKX6	0.946	0.950	2.251E-41	218	0.822	0.826	Q9JKX6.pdb.gz	NUDT5_MOUSE ADP-sugar pyrophosphatase OS=Mus musculus OX=10090 GN=Nudt5 PE=1 SV=1
3	PDB:2dsbA	0.891	0.947	1.514E-40	206	0.941	1.000	2dsbA.pdb.gz
4	AFDB:Q01976	0.877	0.833	1.311E-26	231	0.384	0.364	Q01976.pdb.gz	ADPP_YEAST ADP-ribose pyrophosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YSA1 PE=1 SV=2
5	AFDB:C8VDH4	0.817	0.863	1.224E-22	207	0.356	0.377	C8VDH4.pdb.gz	C8VDH4_EMENI MutT/nudix family protein (AFU_orthologue AFUA_5G08240) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_07711 PE=4 SV=1
6	AFDB:Q383U8	0.855	0.765	1.752E-22	246	0.352	0.313	Q383U8.pdb.gz	Q383U8_TRYB2 NUDIX hydrolase, conserved OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1570 PE=3 SV=1
7	AFDB:Q9P791	0.816	0.870	4.558E-22	205	0.333	0.356	Q9P791.pdb.gz	YN8C_SCHPO Uncharacterized Nudix hydrolase P35G2.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBP35G2.12 PE=3 SV=1
8	AFDB:Q8KP10	0.667	0.776	2.464E-14	185	0.251	0.297	Q8KP10.pdb.gz	ACT_BACMT Methanol dehydrogenase activator OS=Bacillus methanolicus OX=1471 GN=act PE=1 SV=1
9	PDB:3o61D	0.634	0.719	3.604E-13	190	0.201	0.232	3o61D.pdb.gz	Structural studies of the Nudix GDP-mannose hydrolase from E. coli reveals a new motif for mannose recognition.
10	AFDB:P45799	0.629	0.726	1.063E-12	186	0.201	0.237	P45799.pdb.gz	NUDE_ECOLI ADP compounds hydrolase NudE OS=Escherichia coli (strain K12) OX=83333 GN=nudE PE=1 SV=1
11	PDB:1vhzA	0.628	0.724	1.424E-12	186	0.192	0.226	1vhzA.pdb.gz	Structural analysis of a set of proteins resulting from a bacterial genomics project
12	AFDB:O33199	0.646	0.679	3.727E-12	207	0.219	0.232	O33199.pdb.gz	O33199_MYCTO MutT/nudix family protein OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1739 PE=1 SV=1
13	AFDB:P37128	0.628	0.708	4.201E-12	191	0.205	0.236	P37128.pdb.gz	NUDK_ECOLI GDP-mannose pyrophosphatase OS=Escherichia coli (strain K12) OX=83333 GN=nudK PE=1 SV=2
14	PDB:1mqwA	0.635	0.689	1.023E-11	200	0.205	0.225	1mqwA.pdb.gz	Structure and mechanism of MT-ADPRase, a Nudix hydrolase from Mycobacterium tuberculosis
15	PDB:1g9qA	0.569	0.600	1.153E-11	205	0.169	0.180	1g9qA.pdb.gz	The structure of ADP-ribose pyrophosphatase reveals the structural basis for the versatility of the Nudix family.
16	PDB:5t3pC	0.426	0.423	8.211E-7	221	0.114	0.113	5t3pC.pdb.gz
17	PDB:1nqzA	0.386	0.483	1.492E-6	171	0.128	0.164	1nqzA.pdb.gz
18	PDB:2rrkA	0.419	0.598	2.880E-6	140	0.114	0.179	2rrkA.pdb.gz
19	PDB:1ktgA	0.448	0.664	3.657E-6	137	0.114	0.182	1ktgA.pdb.gz	The crystal structure of diadenosine tetraphosphate hydrolase from Caenorhabditis elegans in free and binary complex forms
20	PDB:3ffuA	0.367	0.551	4.375E-6	133	0.132	0.218	3ffuA.pdb.gz	Structure and Biological Function of the RNA Pyrophosphohydrolase BdRppH from Bdellovibrio bacteriovorus.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UKK9	1.17e-164	454	219	1.000	1.000	NUDT5_HUMAN ADP-sugar pyrophosphatase OS=Homo sapiens OX=9606 GN=NUDT5 PE=1 SV=1
2	Q9JKX6	3.64e-137	385	218	0.822	0.826	NUDT5_MOUSE ADP-sugar pyrophosphatase OS=Mus musculus OX=10090 GN=Nudt5 PE=1 SV=1
3	Q01976	7.33e-42	143	231	0.365	0.346	ADPP_YEAST ADP-ribose pyrophosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YSA1 PE=1 SV=2
4	Q9P791	9.56e-41	139	205	0.333	0.356	YN8C_SCHPO Uncharacterized Nudix hydrolase P35G2.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBP35G2.12 PE=3 SV=1
5	C8VDH4	2.70e-40	139	207	0.361	0.382	C8VDH4_EMENI MutT/nudix family protein (AFU_orthologue AFUA_5G08240) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_07711 PE=4 SV=1
6	Q383U8	1.04e-30	115	246	0.384	0.341	Q383U8_TRYB2 NUDIX hydrolase, conserved OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1570 PE=3 SV=1
7	Q8KP10	5.40e-16	75.1	185	0.292	0.346	ACT_BACMT Methanol dehydrogenase activator OS=Bacillus methanolicus OX=1471 GN=act PE=1 SV=1
8	P45799	3.17e-07	50.8	186	0.164	0.194	NUDE_ECOLI ADP compounds hydrolase NudE OS=Escherichia coli (strain K12) OX=83333 GN=nudE PE=1 SV=1
9	Q6MPX4	4.21e-05	44.7	153	0.146	0.209	Q6MPX4_BDEBA Probable pyrophosphohydrolase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100) OX=264462 GN=mutT PE=1 SV=1
10	O33199	3.78e-04	42.4	207	0.114	0.121	O33199_MYCTO MutT/nudix family protein OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1739 PE=1 SV=1
11	P37128	0.002	40.4	191	0.160	0.183	NUDK_ECOLI GDP-mannose pyrophosphatase OS=Escherichia coli (strain K12) OX=83333 GN=nudK PE=1 SV=2
12	P08337	0.004	38.5	129	0.078	0.132	MUTT_ECOLI 8-oxo-dGTP diphosphatase OS=Escherichia coli (strain K12) OX=83333 GN=mutT PE=1 SV=1
13	O45830	0.006	39.3	365	0.110	0.066	NDX1_CAEEL Putative nudix hydrolase 1 OS=Caenorhabditis elegans OX=6239 GN=ndx-1 PE=3 SV=1
14	Q9C6Z2	0.009	38.1	175	0.073	0.091	NUD25_ARATH Nudix hydrolase 25 OS=Arabidopsis thaliana OX=3702 GN=NUDT25 PE=1 SV=1
15	Q9SZ63	0.013	38.1	309	0.091	0.065	NUD14_ARATH Nudix hydrolase 14, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NUDT14 PE=1 SV=2
16	Q9RV46	0.015	37.7	194	0.123	0.139	Y1184_DEIRA Nudix hydrolase DR_1184 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1) OX=243230 GN=DR_1184 PE=1 SV=1
17	Q9X4P2	0.050	35.8	159	0.082	0.113	RPPH_PSEAE RNA pyrophosphohydrolase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=rppH PE=3 SV=1
18	Q9CAF2	0.091	35.4	216	0.068	0.069	NUD26_ARATH Nudix hydrolase 26, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NUDT26 PE=1 SV=1
19	Q9HW06	0.20	34.7	315	0.078	0.054	Q9HW06_PSEAE Probable pyrophosphohydrolase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA4400 PE=3 SV=1
20	Q9CA40	0.27	33.5	147	0.091	0.136	NUDT1_ARATH Nudix hydrolase 1 OS=Arabidopsis thaliana OX=3702 GN=NUDT1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00293 NUDIX	2.2e-12	58.6	NUDIX domain
2	PF07430 PP1	3.6e+02	12.6	Phloem filament protein PP1 cystatin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000419628

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000303575	0.958	ADP-ribose pyrophosphatase, mitochondrial
2	9606.ENSP00000371393	0.927	Phosphoglucomutase-2
3	9606.ENSP00000361512	0.907	Ribose-phosphate pyrophosphokinase 1
4	9606.ENSP00000381504	0.906	Ribose-phosphate pyrophosphokinase 2
5	9606.ENSP00000424595	0.903	Ribose-phosphate pyrophosphokinase 3
6	9606.ENSP00000342502	0.885	Pyrroline-5-carboxylate reductase 2
7	9606.ENSP00000384949	0.882	Pyrroline-5-carboxylate reductase 1, mitochondrial
8	9606.ENSP00000480722	0.874	8-oxo-dGDP phosphatase NUDT18
9	9606.ENSP00000380241	0.868	7,8-dihydro-8-oxoguanine triphosphatase
10	9606.ENSP00000230792	0.861	Peroxisomal NADH pyrophosphatase NUDT12
11	9606.ENSP00000258662	0.861	Nucleotide triphosphate diphosphatase NUDT15
12	9606.ENSP00000334437	0.833	Nucleoside diphosphate-linked moiety X motif 17
13	9606.ENSP00000279206	0.819	Nucleoside diphosphate-linked moiety X motif 22
14	9606.ENSP00000369099	0.807	Manganese-dependent ADP-ribose/CDP-alcohol diphosphatase
15	9606.ENSP00000349874	0.789	Nucleoside diphosphate-linked moiety X motif 13
16	9606.ENSP00000376349	0.778	Uridine diphosphate glucose pyrophosphatase
17	9606.ENSP00000476119	0.758	Diphosphoinositol polyphosphate phosphohydrolase 1
18	9606.ENSP00000338352	0.756	Diphosphoinositol polyphosphate phosphohydrolase 2
19	9606.ENSP00000268533	0.741	Peroxisomal coenzyme A diphosphatase NUDT7
20	9606.ENSP00000422375	0.737	U8 snoRNA-decapping enzyme

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0017110	1.000	nucleoside diphosphate phosphatase activity
GO:0005515	0.999	protein binding
GO:0000287	0.997	magnesium ion binding
GO:0016779	0.996	nucleotidyltransferase activity
GO:0042802	0.948	identical protein binding
GO:0046983	0.911	protein dimerization activity
GO:0042803	0.877	protein homodimerization activity
GO:1901363	0.543	heterocyclic compound binding
GO:0097159	0.543	organic cyclic compound binding
GO:0003676	0.468	nucleic acid binding
GO:0047631	0.393	ADP-ribose diphosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006139	0.995	nucleobase-containing compound metabolic process
GO:1901575	0.983	organic substance catabolic process
GO:0006753	0.982	nucleoside phosphate metabolic process
GO:0034655	0.965	nucleobase-containing compound catabolic process
GO:0009132	0.924	nucleoside diphosphate metabolic process
GO:0009185	0.913	ribonucleoside diphosphate metabolic process
GO:1901135	0.854	carbohydrate derivative metabolic process
GO:1901564	0.728	organonitrogen compound metabolic process
GO:0009117	0.676	nucleotide metabolic process
GO:0043170	0.660	macromolecule metabolic process
GO:0046434	0.513	organophosphate catabolic process
GO:0071840	0.440	cellular component organization or biogenesis
GO:1901292	0.391	nucleoside phosphate catabolic process
GO:0072521	0.390	purine-containing compound metabolic process
GO:0006163	0.343	purine nucleotide metabolic process
GO:0016043	0.307	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005634	0.998	nucleus
GO:0070013	0.893	intracellular organelle lumen
GO:0031982	0.870	vesicle
GO:0005576	0.865	extracellular region
GO:0070062	0.796	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:36799	1.000	a ribonucleoside 5'-diphosphate + H2O = a ribonucleoside 5'-phosphate + H(+) + phosphate
EC:3.6.1.6	1.000	nucleoside diphosphate phosphatase.
EC:2.7.7.-	0.996	Nucleotidyltransferases.
RHEA:10412	0.393	ADP-D-ribose + H2O = AMP + D-ribose 5-phosphate + 2 H(+)
EC:3.6.1.13	0.393	ADP-ribose diphosphatase.

[back to server]