StarFunc result for job id Q9UKL3

User Input

>input (1982 residues)
MAADDDNGDGTSLFDVFSASPLKNNDEGSLDIYAGLDSAVSDSASKSCVPSRNCLDLYEE
ILTEEGTAKEATYNDLQVEYGKCQLQMKELMKKFKEIQTQNFSLINENQSLKKNISALIK
TARVEINRKDEEISNLHQRLSEFPHFRNNHKTARTFDTVKTKDLKSRSPHLDDCSKTDHR
AKSDVSKDVHHSTSLPNLEKEGKPHSDKRSTSHLPTSVEKHCTNGVWSRSHYQVGEGSSN
EDSRRGRKDIRHSQFNRGTERVRKDLSTGCGDGEPRILEASQRLQGHPEKYGKGEPKTES
KSSKFKSNSDSDYKGERINSSWEKETPGERSHSRVDSQSDKKLERQSERSQNINRKEVKS
QDKEERKVDQKPKSVVKDQDHWRRSERASLPHSKNEITFSHNSSKYHLEERRGWEDCKRD
KSVNSHSFQDGRCPSSLSNSRTHKNIDSKEVDAMHQWENTPLKAERHRTEDKRKREQESK
EENRHIRNEKRVPTEHLQKTNKETKKTTTDLKKQNEPKTDKGEVLDNGVSEGADNKELAM
KAESGPNETKNKDLKLSFMKKLNLTLSPAKKQPVSQDNQHKITDIPKSSGVCDSESSMQV
KTVAYVPSISEHILGEAAVSEHTMGETKSTLLEPKVALLAVTEPRIGISETNKEDENSLL
VRSVDNTMHCEEPICGTETSFPSPMEIQQTESLFPSTGMKQTINNGRAAAPVVMDVLQTD
VSQNFGLELDTKRNDNSDYCGISEGMEMKVALSTTVSETTESILQPSIEEADILPIMLSE
DNNPKFEPSVIVTPLVESKSCHLEPCLPKETLDSSLQQTELMDHRMATGETNSVYHDDDN
SVLSIDLNHLRPIPEAISPLNSPVRPVAKVLRNESPPQVPVYNNSHKDVFLPNSAHSTSK
SQSDLNKENQKPIYKSDKCTEADTCKNSPLDELEEGEIRSDSETSKPQESFEKNSKRRVS
ADVRKSKTIPRRGKSTVCLDKDSRKTHVRIHQTNNKWNKRPDKSSRSSKTEKKDKVMSTS
SLEKIVPIIAVPSSEQEIMHMLRMIRKHVRKNYMKFKAKFSLIQFHRIIESAILSFTSLI
KHLNLHKISKSVTTLQKNLCDIIESKLKQVKKNGIVDRLFEQQLPDMKKKLWKFVDDQLD
YLFAKLKKILVCDSKSFGRDSDEGKLEKTSKQNAQYSNSQKRSVDNSNRELLKEKLSKSE
DPVHYKSLVGCKKSEENYQDQNNSSINTVKHDIKKNFNICFDNIKNSQSEERSLEVHCPS
TPKSEKNEGSSIEDAQTSQHATLKPERSFEILTEQQASSLTFNLVSDAQMGEIFKSLLQG
SDLLDSSVNCTEKSEWELKTPEKQLLETLKCESIPACTTEELVSGVASPCPKMISDDNWS
LLSSEKGPSLSSGLSLPVHPDVLDESCMFEVSTNLPLSKDNVCSVEKSKPCVSSILLEDL
AVSLTVPSPLKSDGHLSFLKPDMSSSSTPEEVISAHFSEDALLEEEDASEQDIHLALESD
NSSSKSSCSSSWTSRSVAPGFQYHPNLPMHAVIMEKSNDHFIVKIRRATPSTSSGLKQSM
MPDELLTSLPRHGKEADEGPEKEYISCQNTVFKSVEELENSNKNVDGSKSTHEEQSSMIQ
TQVPDIYEFLKDASDKMGHSDEVADECFKLHQVWETKVPESIEELPSMEEISHSVGEHLP
NTYVDLTKDPVTETKNLGEFIEVTVLHIDQLGCSGGNLNQSAQILDNSLQADTVGAFIDL
TQDASSEAKSEGNHPALAVEDLGCGVIQVDEDNCKEEKAQVANRPLKCIVEETYIDLTTE
SPSSCEVKKDELKSEPGSNCDNSELPGTLHNSHKKRRNISDLNHPHKKQRKETDLTNKEK
TKKPTQDSCENTEAHQKKASKKKAPPVTKDPSSLKATPGIKDSSAALATSTSLSAKNVIK
KKGEIIILWTRNDDREILLECQKRGPSFKTFAYLAAKLDKNPNQVSERFQQLMKLFEKSK
CR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A7V6	0.221	0.222	0.000	1962	0.655	0.662	D4A7V6.pdb.gz	D4A7V6_RAT Caspase 8 associated protein 2 OS=Rattus norvegicus OX=10116 GN=Casp8ap2 PE=1 SV=1
2	AFDB:Q9UKL3	1.000	1.000	0.000	1982	1.000	1.000	Q9UKL3.pdb.gz	C8AP2_HUMAN CASP8-associated protein 2 OS=Homo sapiens OX=9606 GN=CASP8AP2 PE=1 SV=1
3	AFDB:Q9WUF3	0.277	0.279	0.000	1962	0.664	0.671	Q9WUF3.pdb.gz	C8AP2_MOUSE CASP8-associated protein 2 OS=Mus musculus OX=10090 GN=Casp8ap2 PE=1 SV=2
4	AFDB:Q6FRV6	0.041	0.038	3.309E-5	2238	0.142	0.126	Q6FRV6.pdb.gz	SEC16_CANGA COPII coat assembly protein SEC16 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=SEC16 PE=3 SV=1
5	AFDB:Q8N3D4	0.037	0.040	1.618E-3	1523	0.079	0.102	Q8N3D4.pdb.gz	EH1L1_HUMAN EH domain-binding protein 1-like protein 1 OS=Homo sapiens OX=9606 GN=EHBP1L1 PE=1 SV=2
6	AFDB:P48415	0.031	0.029	2.414E-3	2195	0.140	0.127	P48415.pdb.gz	SEC16_YEAST COPII coat assembly protein SEC16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC16 PE=1 SV=2
7	AFDB:D3ZRA6	0.030	0.032	3.402E-3	1683	0.118	0.138	D3ZRA6.pdb.gz	D3ZRA6_RAT Trinucleotide repeat containing adaptor 6C OS=Rattus norvegicus OX=10116 GN=Tnrc6c PE=1 SV=4
8	AFDB:Q03661	0.038	0.044	7.157E-3	1658	0.139	0.166	Q03661.pdb.gz	ESC1_YEAST Silent chromatin protein ESC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ESC1 PE=1 SV=1
9	AFDB:A8DZ29	0.040	0.040	8.997E-3	1919	0.106	0.110	A8DZ29.pdb.gz	A8DZ29_DROME Eukaryotic translation initiation factor 4G1, isoform B OS=Drosophila melanogaster OX=7227 GN=eIF4G1 PE=1 SV=1
10	AFDB:Q9Y2F5	0.040	0.036	1.268E-2	2266	0.138	0.121	Q9Y2F5.pdb.gz	ICE1_HUMAN Little elongation complex subunit 1 OS=Homo sapiens OX=9606 GN=ICE1 PE=1 SV=5
11	PDB:6elzb	0.050	0.173	1.604E-1	421	0.010	0.048	6elzb.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
12	PDB:6n8jb	0.049	0.121	5.977E-1	647	0.011	0.034	6n8jb.pdb.gz	Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
13	PDB:2cg4A	0.022	0.275	6.701E-1	149	0.005	0.067	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
14	PDB:7naod	0.026	0.151	6.701E-1	217	0.010	0.088	7naod.pdb.gz
15	PDB:1wn0C	0.041	0.351	1.000	138	0.005	0.072	1wn0C.pdb.gz
16	PDB:7n8oQ	0.040	0.292	1.000	119	0.009	0.143	7n8oQ.pdb.gz	High-resolution cryo-electron microscopy structure of photosystem II from the mesophilic cyanobacterium, Synechocystis sp. PCC 6803.
17	PDB:6ylgb	0.051	0.140	1.121	613	0.011	0.034	6ylgb.pdb.gz	Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.
18	PDB:7o4i1	0.041	0.112	1.187	522	0.011	0.040	7o4i1.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
19	PDB:4eukB	0.024	0.210	1.257	152	0.011	0.138	4eukB.pdb.gz	Structure-Function Analysis of Arabidopsis thaliana Histidine Kinase AHK5 Bound to Its Cognate Phosphotransfer Protein AHP1.
20	PDB:7l1kB	0.038	0.070	2.104	660	0.009	0.026	7l1kB.pdb.gz	Molecular mechanism of N-terminal acetylation by the ternary NatC complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4A7V6	0.0	2423	1962	0.655	0.662	D4A7V6_RAT Caspase 8 associated protein 2 OS=Rattus norvegicus OX=10116 GN=Casp8ap2 PE=1 SV=1
2	Q9UKL3	0.0	4067	1982	1.000	1.000	C8AP2_HUMAN CASP8-associated protein 2 OS=Homo sapiens OX=9606 GN=CASP8AP2 PE=1 SV=1
3	Q9WUF3	0.0	2489	1962	0.664	0.671	C8AP2_MOUSE CASP8-associated protein 2 OS=Mus musculus OX=10090 GN=Casp8ap2 PE=1 SV=2
4	F1QI87	2.03e-09	65.5	2055	0.022	0.021	F1QI87_DANRE GON-4-like protein OS=Danio rerio OX=7955 GN=fb99g07 PE=4 SV=1
5	Q3T8J9	1.09e-07	60.1	2241	0.017	0.015	GON4L_HUMAN GON-4-like protein OS=Homo sapiens OX=9606 GN=GON4L PE=1 SV=1
6	Q9DB00	1.98e-07	58.9	2260	0.015	0.013	GON4L_MOUSE GON-4-like protein OS=Mus musculus OX=10090 GN=Gon4l PE=1 SV=3
7	Q9UPQ9	0.057	41.2	1833	0.022	0.023	TNR6B_HUMAN Trinucleotide repeat-containing gene 6B protein OS=Homo sapiens OX=9606 GN=TNRC6B PE=1 SV=4
8	Q7K0L8	3.1	35.4	844	0.018	0.043	Q7K0L8_DROME FLICE-associated huge protein, isoform A OS=Drosophila melanogaster OX=7227 GN=FLASH PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000478179

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351273	0.989	Caspase-8
2	9606.ENSP00000348056	0.948	SUMO-conjugating enzyme UBC9
3	9606.ENSP00000249636	0.933	E3 SUMO-protein ligase PIAS1
4	9606.ENSP00000482063	0.910	Polycomb group RING finger protein 2
5	9606.ENSP00000257118	0.902	Polyhomeotic-like protein 2
6	9606.ENSP00000269397	0.902	E3 SUMO-protein ligase CBX4
7	9606.ENSP00000308750	0.902	Chromobox protein homolog 2
8	9606.ENSP00000356480	0.902	E3 ubiquitin-protein ligase RING2
9	9606.ENSP00000363787	0.902	E3 ubiquitin-protein ligase RING1
10	9606.ENSP00000420294	0.902	Polyhomeotic-like protein 3
11	9606.ENSP00000440674	0.902	Polyhomeotic-like protein 1
12	9606.ENSP00000262971	0.900	E3 SUMO-protein ligase PIAS4
13	9606.ENSP00000269385	0.900	Chromobox protein homolog 8
14	9606.ENSP00000318094	0.900	Polycomb protein SCMH1
15	9606.ENSP00000376077	0.854	Small ubiquitin-related modifier 1
16	9606.ENSP00000286307	0.728	U7 snRNA-associated Sm-like protein LSm11
17	9606.ENSP00000278612	0.701	Protein NPAT
18	9606.ENSP00000301838	0.612	FAS-associated death domain protein
19	9606.ENSP00000238112	0.609	Cleavage and polyadenylation specificity factor subunit 3
20	9606.ENSP00000357393	0.573	Ephrin-A3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003714	1.000	transcription corepressor activity
GO:0032183	1.000	SUMO binding
GO:0005123	1.000	death receptor binding
GO:0032184	0.985	SUMO polymer binding
GO:0019899	0.348	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0009987	0.998	cellular process
GO:0050794	0.990	regulation of cellular process
GO:0019222	0.982	regulation of metabolic process
GO:0060255	0.974	regulation of macromolecule metabolic process
GO:0048518	0.966	positive regulation of biological process
GO:0050896	0.947	response to stimulus
GO:0080090	0.932	regulation of primary metabolic process
GO:0051171	0.932	regulation of nitrogen compound metabolic process
GO:0010604	0.927	positive regulation of macromolecule metabolic process
GO:0051173	0.924	positive regulation of nitrogen compound metabolic process
GO:0065009	0.917	regulation of molecular function
GO:0051246	0.917	regulation of protein metabolic process
GO:0051716	0.897	cellular response to stimulus
GO:0023052	0.881	signaling
GO:0007154	0.881	cell communication
GO:0051247	0.871	positive regulation of protein metabolic process
GO:0006915	0.864	apoptotic process
GO:0030162	0.853	regulation of proteolysis
GO:0043085	0.845	positive regulation of catalytic activity
GO:0007166	0.813	cell surface receptor signaling pathway
GO:0097190	0.771	apoptotic signaling pathway
GO:0052548	0.766	regulation of endopeptidase activity
GO:0045862	0.763	positive regulation of proteolysis
GO:0097191	0.756	extrinsic apoptotic signaling pathway
GO:2000116	0.749	regulation of cysteine-type endopeptidase activity
GO:0010950	0.741	positive regulation of endopeptidase activity
GO:0008625	0.715	extrinsic apoptotic signaling pathway via death domain receptors
GO:2001056	0.711	positive regulation of cysteine-type endopeptidase activity
GO:0043281	0.646	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0043280	0.637	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0006919	0.610	activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0008152	0.500	metabolic process
GO:0009628	0.489	response to abiotic stimulus
GO:0071704	0.453	organic substance metabolic process
GO:0031323	0.415	regulation of cellular metabolic process
GO:0010468	0.388	regulation of gene expression
GO:0048522	0.368	positive regulation of cellular process
GO:0009605	0.352	response to external stimulus
GO:0104004	0.325	cellular response to environmental stimulus
GO:0071496	0.321	cellular response to external stimulus
GO:0071214	0.312	cellular response to abiotic stimulus
GO:0044238	0.307	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	1.000	nucleoplasm
GO:0016604	0.987	nuclear body
GO:0005739	0.958	mitochondrion
GO:0032991	0.938	protein-containing complex
GO:0016605	0.787	PML body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]