StarFunc result for job id Q9UKM7

User Input

>input (699 residues)
MAACEGRRSGALGSSQSDFLTPPVGGAPWAVATTVVMYPPPPPPPHRDFISVTLSFGENY
DNSKSWRRRSCWRKWKQLSRLQRNMILFLLAFLLFCGLLFYINLADHWKALAFRLEEEQK
MRPEIAGLKPANPPVLPAPQKADTDPENLPEISSQKTQRHIQRGPPHLQIRPPSQDLKDG
TQEEATKRQEAPVDPRPEGDPQRTVISWRGAVIEPEQGTELPSRRAEVPTKPPLPPARTQ
GTPVHLNYRQKGVIDVFLHAWKGYRKFAWGHDELKPVSRSFSEWFGLGLTLIDALDTMWI
LGLRKEFEEARKWVSKKLHFEKDVDVNLFESTIRILGGLLSAYHLSGDSLFLRKAEDFGN
RLMPAFRTPSKIPYSDVNIGTGVAHPPRWTSDSTVAEVTSIQLEFRELSRLTGDKKFQEA
VEKVTQHIHGLSGKKDGLVPMFINTHSGLFTHLGVFTLGARADSYYEYLLKQWIQGGKQE
TQLLEDYVEAIEGVRTHLLRHSEPSKLTFVGELAHGRFSAKMDHLVCFLPGTLALGVYHG
LPASHMELAQELMETCYQMNRQMETGLSPEIVHFNLYPQPGRRDVEVKPADRHNLLRPET
VESLFYLYRVTGDRKYQDWGWEILQSFSRFTRVPSGGYSSINNVQDPQKPEPRDKMESFF
LGETLKYLFLLFSDDPNLLSLDAYVFNTEAHPLPIWTPA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UKM7	1.000	1.000	0.000	699	1.000	1.000	Q9UKM7.pdb.gz	MA1B1_HUMAN Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN1B1 PE=1 SV=2
2	AFDB:A2AJ15	0.763	0.808	1.063E-84	658	0.734	0.780	A2AJ15.pdb.gz	MA1B1_MOUSE Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Mus musculus OX=10090 GN=Man1b1 PE=1 SV=1
3	AFDB:Q9C512	0.616	0.765	3.475E-43	560	0.298	0.371	Q9C512.pdb.gz	MNS1_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 OS=Arabidopsis thaliana OX=3702 GN=MNS1 PE=1 SV=1
4	AFDB:Q8H116	0.610	0.743	5.075E-43	572	0.288	0.351	Q8H116.pdb.gz	MNS2_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana OX=3702 GN=MNS2 PE=1 SV=1
5	AFDB:A0A1D8PD38	0.624	0.708	5.407E-42	615	0.310	0.353	A0A1D8PD38.pdb.gz	A0A1D8PD38_CANAL alpha-1,2-Mannosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNS1 PE=3 SV=1
6	AFDB:Q9P7C3	0.624	0.833	1.940E-41	521	0.272	0.365	Q9P7C3.pdb.gz	MNS1_SCHPO Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2E1P5.01c PE=1 SV=2
7	AFDB:P45700	0.633	0.674	7.654E-41	655	0.295	0.315	P45700.pdb.gz	MA1A1_MOUSE Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Mus musculus OX=10090 GN=Man1a1 PE=1 SV=1
8	AFDB:O60476	0.629	0.685	1.485E-40	641	0.256	0.279	O60476.pdb.gz	MA1A2_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Homo sapiens OX=9606 GN=MAN1A2 PE=1 SV=1
9	PDB:1dl2A	0.607	0.827	1.587E-38	510	0.275	0.376	1dl2A.pdb.gz
10	PDB:2rgkA	0.333	0.510	1.945E-5	409	0.074	0.127	2rgkA.pdb.gz
11	PDB:1fp3A	0.360	0.570	3.432E-5	402	0.076	0.132	1fp3A.pdb.gz
12	PDB:3qxqA	0.271	0.461	3.488E-4	338	0.063	0.130	3qxqA.pdb.gz	Apo- and cellopentaose-bound structures of the bacterial cellulose synthase subunit BcsZ.
13	PDB:6wq1A	0.332	0.524	7.094E-4	396	0.092	0.162	6wq1A.pdb.gz	LanCLs add glutathione to dehydroamino acids generated at phosphorylated sites in the proteome.
14	PDB:3e6uA	0.328	0.506	3.076E-3	409	0.077	0.132	3e6uA.pdb.gz	Structure of human lanthionine synthetase C-like protein 1 and its interaction with Eps8 and glutathione
15	PDB:3aniA	0.294	0.472	4.086E-3	378	0.069	0.127	3aniA.pdb.gz
16	PDB:1ut9A	0.245	0.274	4.492E-3	605	0.080	0.093	1ut9A.pdb.gz
17	PDB:3vxdC	0.277	0.469	5.691E-3	359	0.063	0.123	3vxdC.pdb.gz
18	PDB:3t33A	0.344	0.536	1.612E-2	407	0.090	0.155	3t33A.pdb.gz	Crystal Structure of Arabidopsis GCR2 Identifies a Novel Clade of Lantibiotic Cyclase-Like Proteins
19	AFDB:Q8BIZ8	0.085	0.072	2.881E-2	905	0.134	0.104	Q8BIZ8.pdb.gz	Q8BIZ8_MOUSE S phase cyclin A-associated protein in the ER OS=Mus musculus OX=10090 GN=Scaper PE=1 SV=1
20	AFDB:Q9Y2M0	0.097	0.080	1.824E-1	1017	0.112	0.077	Q9Y2M0.pdb.gz	FAN1_HUMAN Fanconi-associated nuclease 1 OS=Homo sapiens OX=9606 GN=FAN1 PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2AJ15	0.0	1051	658	0.725	0.771	MA1B1_MOUSE Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Mus musculus OX=10090 GN=Man1b1 PE=1 SV=1
2	Q9UKM7	0.0	1442	699	1.000	1.000	MA1B1_HUMAN Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN1B1 PE=1 SV=2
3	Q9VAP8	1.06e-176	522	685	0.412	0.420	Q9VAP8_DROME alpha-1,2-Mannosidase OS=Drosophila melanogaster OX=7227 GN=alpha-Man-Ib PE=1 SV=1
4	Q93Y37	2.98e-137	418	624	0.339	0.380	MNS3_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 OS=Arabidopsis thaliana OX=3702 GN=MNS3 PE=1 SV=1
5	Q9C512	5.41e-121	374	560	0.302	0.377	MNS1_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 OS=Arabidopsis thaliana OX=3702 GN=MNS1 PE=1 SV=1
6	A2RBC3	1.64e-120	374	603	0.302	0.350	A2RBC3_ASPNC alpha-1,2-Mannosidase OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An18g06220 PE=3 SV=1
7	A0A1D8PD38	6.80e-117	365	615	0.308	0.350	A0A1D8PD38_CANAL alpha-1,2-Mannosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNS1 PE=3 SV=1
8	Q8H116	1.32e-114	358	572	0.293	0.358	MNS2_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana OX=3702 GN=MNS2 PE=1 SV=1
9	Q9P7C3	6.59e-113	352	521	0.279	0.374	MNS1_SCHPO Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2E1P5.01c PE=1 SV=2
10	Q2UMC2	2.17e-106	341	711	0.305	0.300	Q2UMC2_ASPOR alpha-1,2-Mannosidase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003000057 PE=3 SV=1
11	P45700	2.19e-106	339	655	0.308	0.328	MA1A1_MOUSE Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Mus musculus OX=10090 GN=Man1a1 PE=1 SV=1
12	P53624	3.94e-103	331	667	0.263	0.276	MA1A1_DROME Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Drosophila melanogaster OX=7227 GN=alpha-Man-Ia PE=2 SV=2
13	P39098	2.24e-102	328	641	0.303	0.331	MA1A2_MOUSE Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Mus musculus OX=10090 GN=Man1a2 PE=1 SV=1
14	P33908	5.52e-102	328	653	0.305	0.326	MA1A1_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Homo sapiens OX=9606 GN=MAN1A1 PE=1 SV=3
15	O18498	6.15e-102	328	670	0.302	0.315	MA1A1_SPOFR Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Spodoptera frugiperda OX=7108 PE=1 SV=1
16	O60476	1.16e-101	327	641	0.318	0.346	MA1A2_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Homo sapiens OX=9606 GN=MAN1A2 PE=1 SV=1
17	Q9NR34	3.17e-96	312	630	0.282	0.313	MA1C1_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IC OS=Homo sapiens OX=9606 GN=MAN1C1 PE=1 SV=1
18	P32906	9.82e-94	303	549	0.273	0.348	MNS1_YEAST Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNS1 PE=1 SV=1
19	Q9SXC9	7.62e-58	207	574	0.220	0.268	MNS5_ARATH Alpha-mannosidase I MNS5 OS=Arabidopsis thaliana OX=3702 GN=MNS5 PE=1 SV=1
20	Q8MS36	5.73e-56	206	801	0.219	0.191	Q8MS36_DROME alpha-1,2-Mannosidase OS=Drosophila melanogaster OX=7227 GN=Edem2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01532 Glyco_hydro_47	2.7e-159	542.6	Glycosyl hydrolase family 47

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360645

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340466	0.946	Neutral alpha-glucosidase AB
2	9606.ENSP00000351669	0.920	Glycoprotein endo-alpha-1,2-mannosidase
3	9606.ENSP00000348959	0.918	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB
4	9606.ENSP00000357453	0.916	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA
5	9606.ENSP00000363452	0.915	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IC
6	9606.ENSP00000466134	0.913	Glucosidase 2 subunit beta
7	9606.ENSP00000233616	0.888	Mannosyl-oligosaccharide glucosidase
8	9606.ENSP00000261483	0.854	Alpha-mannosidase 2
9	9606.ENSP00000185150	0.842	Endoplasmic reticulum lectin 1
10	9606.ENSP00000318165	0.841	Protein OS-9
11	9606.ENSP00000475168	0.819	Protein RER1
12	9606.ENSP00000259253	0.789	UDP-glucose:glycoprotein glucosyltransferase 1
13	9606.ENSP00000380793	0.748	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase
14	9606.ENSP00000457788	0.746	Alpha-mannosidase 2C1
15	9606.ENSP00000337053	0.730	Protein sel-1 homolog 1
16	9606.ENSP00000399457	0.729	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit
17	9606.ENSP00000360635	0.715	Dipeptidyl peptidase 2
18	9606.ENSP00000417764	0.693	Alpha-1,3/1,6-mannosyltransferase ALG2
19	9606.ENSP00000247461	0.674	Calnexin
20	9606.ENSP00000288050	0.659	Pyruvate dehydrogenase phosphatase regulatory subunit, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004571	1.000	mannosyl-oligosaccharide 1,2-alpha-mannosidase activity
GO:0005509	0.999	calcium ion binding
GO:0005515	0.830	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0043412	0.975	macromolecule modification
GO:0044260	0.975	cellular macromolecule metabolic process
GO:0019538	0.975	protein metabolic process
GO:0009100	0.969	glycoprotein metabolic process
GO:0036211	0.967	protein modification process
GO:0006517	0.946	protein deglycosylation
GO:0030433	0.891	ubiquitin-dependent ERAD pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0012505	1.000	endomembrane system
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005794	0.993	Golgi apparatus
GO:0031982	0.985	vesicle
GO:0005576	0.972	extracellular region
GO:0005783	0.971	endoplasmic reticulum
GO:0031090	0.939	organelle membrane
GO:1903561	0.920	extracellular vesicle
GO:0070062	0.846	extracellular exosome
GO:0031410	0.689	cytoplasmic vesicle
GO:0031984	0.651	organelle subcompartment
GO:0098588	0.352	bounding membrane of organelle
GO:0005789	0.333	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.1.113	1.000	mannosyl-oligosaccharide 1,2-alpha-mannosidase.

[back to server]