StarFunc result for job id Q9UKN1

User Input

>input (1400 residues)
MLVIWILTLALRLCASVTTVTPEGSAVHKAISQQGTLWTGEVLEKQTVEQGKSTLRRQKN
HFHRSAGELRCRNALKDEGASAGWSVMFAGESVVVLVHLWMTGARVKNLGLVEFASPGDD
GDGRAEGFSLGLPLSEQARAAGAREKERQETVINHSTFSGFSQITGSTVNTSIGGNTTSA
STPSSSDPFTTFSDYGVSVTFITGSTATKHFLDSSTNSGHSEESTVSHSGPGATGTTLFP
SHSATSVFVGEPKTSPITSASMETTALPGSTTTAGLSEKSTTFYSSPRSPDRTLSPARTT
SSGVSEKSTTSHSRPGPTHTIAFPDSTTMPGVSQESTASHSIPGSTDTTLSPGTTTPSSL
GPESTTFHSSPGYTKTTRLPDNTTTSGLLEASTPVHSSTGSPHTTLSPSSSTTHEGEPTT
FQSWPSSKDTSPAPSGTTSAFVKLSTTYHSSPSSTPTTHFSASSTTLGHSEESTPVHSSP
VATATTPPPARSATSGHVEESTAYHRSPGSTQTMHFPESSTTSGHSEESATFHGSTTHTK
SSTPSTTAALAHTSYHSSLGSTETTHFRDSSTISGRSEESKASHSSPDAMATTVLPAGST
PSVLVGDSTPSPISSGSMETTALPGSTTKPGLSEKSTTFYSSPRSPDTTHLPASMTSSGV
SEESTTSHSRPGSTHTTAFPGSTTMPGLSQESTASHSSPGPTDTTLSPGSTTASSLGPEY
TTFHSRPGSTETTLLPDNTTASGLLEASMPVHSSTRSPHTTLSPAGSTTRQGESTTFHSW
PSSKDTRPAPPTTTSAFVEPSTTSHGSPSSIPTTHISARSTTSGLVEESTTYHSSPGSTQ
TMHFPESDTTSGRGEESTTSHSSTTHTISSAPSTTSALVEEPTSYHSSPGSTATTHFPDS
STTSGRSEESTASHSSQDATGTIVLPARSTTSVLLGESTTSPISSGSMETTALPGSTTTP
GLSERSTTFHSSPRSPATTLSPASTTSSGVSEESTTSRSRPGSTHTTAFPDSTTTPGLSR
HSTTSHSSPGSTDTTLLPASTTTSGPSQESTTSHSSSGSTDTALSPGSTTALSFGQESTT
FHSNPGSTHTTLFPDSTTSSGIVEASTRVHSSTGSPRTTLSPASSTSPGLQGESTAFQTH
PASTHTTPSPPSTATAPVEESTTYHRSPGSTPTTHFPASSTTSGHSEKSTIFHSSPDASG
TTPSSAHSTTSGRGESTTSRISPGSTEITTLPGSTTTPGLSEASTTFYSSPRSPTTTLSP
ASMTSLGVGEESTTSRSQPGSTHSTVSPASTTTPGLSEESTTVYSSSRGSTETTVFPHST
TTSVHGEEPTTFHSRPASTHTTLFTEDSTTSGLTEESTAFPGSPASTQTGLPATLTTADL
GEESTTFPSSSGSTGTKLSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14031	0.039	0.035	4.376E-5	1691	0.185	0.153	Q14031.pdb.gz	CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens OX=9606 GN=COL4A6 PE=1 SV=3
2	AFDB:P17140	0.031	0.026	5.952E-5	1758	0.173	0.138	P17140.pdb.gz	CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans OX=6239 GN=let-2 PE=1 SV=2
3	AFDB:Q8BLX7	0.039	0.036	2.770E-4	1580	0.164	0.146	Q8BLX7.pdb.gz	COGA1_MOUSE Collagen alpha-1(XVI) chain OS=Mus musculus OX=10090 GN=Col16a1 PE=1 SV=2
4	AFDB:Q07092	0.032	0.030	3.231E-4	1604	0.163	0.142	Q07092.pdb.gz	COGA1_HUMAN Collagen alpha-1(XVI) chain OS=Homo sapiens OX=9606 GN=COL16A1 PE=1 SV=2
5	AFDB:Q63ZW6	0.036	0.030	6.455E-4	1691	0.166	0.137	Q63ZW6.pdb.gz	Q63ZW6_MOUSE Col4a5 protein OS=Mus musculus OX=10090 GN=Col4a5 PE=1 SV=1
6	AFDB:B1AVK5	0.035	0.032	1.194E-3	1691	0.179	0.148	B1AVK5.pdb.gz	B1AVK5_MOUSE Collagen, type IV, alpha 6 OS=Mus musculus OX=10090 GN=Col4a6 PE=1 SV=1
7	AFDB:P17139	0.032	0.028	2.576E-3	1759	0.159	0.127	P17139.pdb.gz	CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans OX=6239 GN=emb-9 PE=1 SV=5
8	AFDB:E7F630	0.032	0.022	2.782E-3	2394	0.171	0.100	E7F630.pdb.gz
9	AFDB:G3MXK9	0.031	0.034	8.816E-3	1257	0.130	0.145	G3MXK9.pdb.gz	G3MXK9_BOVIN Collagen type XVI alpha 1 chain OS=Bos taurus OX=9913 GN=COL16A1 PE=4 SV=2
10	AFDB:B4UN32	0.027	0.028	1.028E-2	1208	0.132	0.153	B4UN32.pdb.gz	AWP3B_CANGA Adhesin AWP3b OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=AWP3b PE=1 SV=2
11	PDB:4wspA	0.027	0.401	5.844E-2	79	0.006	0.101	4wspA.pdb.gz
12	PDB:6u9fB	0.021	0.102	2.720E-1	133	0.006	0.060	6u9fB.pdb.gz
13	PDB:7nvrd	0.020	0.058	2.938E-1	439	0.004	0.011	7nvrd.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.
14	PDB:2k8pA	0.020	0.109	3.426E-1	189	0.016	0.122	2k8pA.pdb.gz
15	PDB:6i7sG	0.027	0.043	3.426E-1	863	0.003	0.005	6i7sG.pdb.gz	The crystal structure of human microsomal triglyceride transfer protein.
16	PDB:7qooP	0.031	0.131	4.315E-1	233	0.003	0.017	7qooP.pdb.gz	Structure of the human inner kinetochore CCAN complex and its significance for human centromere organization.
17	PDB:7d3eB	0.029	0.113	5.032E-1	272	0.006	0.033	7d3eB.pdb.gz	Structures of human dual oxidase 1 complex in low-calcium and high-calcium states.
18	PDB:2gjeD	0.030	0.226	5.435E-1	147	0.005	0.048	2gjeD.pdb.gz	Crystal Structures of T. brucei MRP1/MRP2 Guide-RNA Binding Complex Reveal RNA Matchmaking Mechanism.
19	PDB:2luuA	0.020	0.124	6.338E-1	127	0.009	0.094	2luuA.pdb.gz
20	PDB:3r07C	0.022	0.267	6.338E-1	88	0.002	0.034	3r07C.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UKN1	0.0	1332	5478	0.674	0.172	MUC12_HUMAN Mucin-12 OS=Homo sapiens OX=9606 GN=MUC12 PE=1 SV=2
2	D3YVF0	2.2	35.0	745	0.056	0.106	AKAP5_MOUSE A-kinase anchor protein 5 OS=Mus musculus OX=10090 GN=Akap5 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000441929

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000485028	0.982	Mucin-13
2	9606.ENSP00000416753	0.981	Mucin-15
3	9606.ENSP00000407422	0.979	Mucin-7
4	9606.ENSP00000414350	0.979	Mucin-20
5	9606.ENSP00000381008	0.975	Mucin-16
6	9606.ENSP00000406861	0.975	Mucin-6
7	9606.ENSP00000436812	0.975	Mucin-5B
8	9606.ENSP00000365473	0.973	Mucin-21
9	9606.ENSP00000485659	0.971	Mucin-5AC
10	9606.ENSP00000484824	0.966	Mucin-1
11	9606.ENSP00000302716	0.942	Mucin-17
12	9606.ENSP00000368771	0.942	Mucin-3A
13	9606.ENSP00000417498	0.939	Mucin-4
14	9606.ENSP00000415454	0.929	Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase
15	9606.ENSP00000311364	0.922	Mucin-like protein 1
16	9606.ENSP00000379377	0.921	Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3
17	9606.ENSP00000364150	0.919	Polypeptide N-acetylgalactosaminyltransferase 12
18	9606.ENSP00000484640	0.916	Acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase
19	9606.ENSP00000297107	0.914	Polypeptide N-acetylgalactosaminyltransferase 10
20	9606.ENSP00000389176	0.914	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.455	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005796	0.999	Golgi lumen
GO:0098590	0.419	plasma membrane region
GO:0045177	0.377	apical part of cell

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]