StarFunc result for job id Q9UKP4

User Input

>input (1686 residues)
MPGGPSPRSPAPLLRPLLLLLCALAPGAPGPAPGRATEGRAALDIVHPVRVDAGGSFLSY
ELWPRALRKRDVSVRRDAPAFYELQYRGRELRFNLTANQHLLAPGFVSETRRRGGLGRAH
IRAHTPACHLLGEVQDPELEGGLAAISACDGLKGVFQLSNEDYFIEPLDSAPARPGHAQP
HVVYKRQAPERLAQRGDSSAPSTCGVQVYPELESRRERWEQRQQWRRPRLRRLHQRSVSK
EKWVETLVVADAKMVEYHGQPQVESYVLTIMNMVAGLFHDPSIGNPIHITIVRLVLLEDE
EEDLKITHHADNTLKSFCKWQKSINMKGDAHPLHHDTAILLTRKDLCAAMNRPCETLGLS
HVAGMCQPHRSCSINEDTGLPLAFTVAHELGHSFGIQHDGSGNDCEPVGKRPFIMSPQLL
YDAAPLTWSRCSRQYITRFLDRGWGLCLDDPPAKDIIDFPSVPPGVLYDVSHQCRLQYGA
YSAFCEDMDNVCHTLWCSVGTTCHSKLDAAVDGTRCGENKWCLSGECVPVGFRPEAVDGG
WSGWSAWSICSRSCGMGVQSAERQCTQPTPKYKGRYCVGERKRFRLCNLQACPAGRPSFR
HVQCSHFDAMLYKGQLHTWVPVVNDVNPCELHCRPANEYFAEKLRDAVVDGTPCYQVRAS
RDLCINGICKNVGCDFEIDSGAMEDRCGVCHGNGSTCHTVSGTFEEAEGLGYVDVGLIPA
GAREIRIQEVAEAANFLALRSEDPEKYFLNGGWTIQWNGDYQVAGTTFTYARRGNWENLT
SPGPTKEPVWIQLLFQESNPGVHYEYTIHREAGGHDEVPPPVFSWHYGPWTKCTVTCGRG
VQRQNVYCLERQAGPVDEEHCDPLGRPDDQQRKCSEQPCPARWWAGEWQLCSSSCGPGGL
SRRAVLCIRSVGLDEQSALEPPACEHLPRPPTETPCNRHVPCPATWAVGNWSQCSVTCGE
GTQRRNVLCTNDTGVPCDEAQQPASEVTCSLPLCRWPLGTLGPEGSGSGSSSHELFNEAD
FIPHHLAPRPSPASSPKPGTMGNAIEEEAPELDLPGPVFVDDFYYDYNFINFHEDLSYGP
SEEPDLDLAGTGDRTPPPHSHPAAPSTGSPVPATEPPAAKEEGVLGPWSPSPWPSQAGRS
PPPPSEQTPGNPLINFLPEEDTPIGAPDLGLPSLSWPRVSTDGLQTPATPESQNDFPVGK
DSQSQLPPPWRDRTNEVFKDDEEPKGRGAPHLPPRPSSTLPPLSPVGSTHSSPSPDVAEL
WTGGTVAWEPALEGGLGPVDSELWPTVGVASLLPPPIAPLPEMKVRDSSLEPGTPSFPTP
GPGSWDLQTVAVWGTFLPTTLTGLGHMPEPALNPGPKGQPESLSPEVPLSSRLLSTPAWD
SPANSHRVPETQPLAPSLAEAGPPADPLVVRNAGWQAGNWSECSTTCGLGAVWRPVRCSS
GRDEDCAPAGRPQPARRCHLRPCATWHSGNWSKCSRSCGGGSSVRDVQCVDTRDLRPLRP
FHCQPGPAKPPAHRPCGAQPCLSWYTSSWRECSEACGGGEQQRLVTCPEPGLCEEALRPN
TTRPCNTHPCTQWVVGPWGQCSGPCGGGVQRRLVKCVNTQTGLPEEDSDQCGHEAWPESS
RPCGTEDCEPVEPPRCERDRLSFGFCETLRLLGRCQLPTIRTQCCRSCSPPSHGAPSRGH
QRVARR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q68SA9	0.479	0.486	0.000	1657	0.721	0.733	Q68SA9.pdb.gz	ATS7_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 7 OS=Mus musculus OX=10090 GN=Adamts7 PE=1 SV=3
2	AFDB:Q811B3	0.478	0.500	0.000	1600	0.435	0.459	Q811B3.pdb.gz	ATS12_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Mus musculus OX=10090 GN=Adamts12 PE=2 SV=2
3	AFDB:Q9UKP4	1.000	1.000	0.000	1686	1.000	1.000	Q9UKP4.pdb.gz	ATS7_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 7 OS=Homo sapiens OX=9606 GN=ADAMTS7 PE=1 SV=2
4	AFDB:Q69Z28	0.343	0.460	2.952E-103	1222	0.259	0.357	Q69Z28.pdb.gz	ATS16_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Mus musculus OX=10090 GN=Adamts16 PE=2 SV=2
5	AFDB:Q8TE60	0.348	0.470	3.616E-102	1221	0.247	0.341	Q8TE60.pdb.gz	ATS18_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Homo sapiens OX=9606 GN=ADAMTS18 PE=1 SV=3
6	AFDB:E7FFX0	0.334	0.448	3.914E-100	1224	0.254	0.350	E7FFX0.pdb.gz	E7FFX0_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Danio rerio OX=7955 GN=LOC568792 PE=4 SV=3
7	AFDB:Q4VC17	0.352	0.472	5.962E-99	1219	0.252	0.349	Q4VC17.pdb.gz	ATS18_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Mus musculus OX=10090 GN=Adamts18 PE=2 SV=2
8	AFDB:Q6QU65	0.208	0.242	1.781E-18	1407	0.148	0.177	Q6QU65.pdb.gz	Q6QU65_DROME ADAM metalloprotease OS=Drosophila melanogaster OX=7227 GN=Meltrin PE=1 SV=1
9	PDB:4q1lA	0.111	0.860	1.816E-13	202	0.034	0.282	4q1lA.pdb.gz	Complete amino-acid sequence, crystallization and preliminary X-ray diffraction studies of leucurolysin-a, a nonhaemorrhagic metalloproteinase from Bothrops leucurus snake venom.
10	PDB:1w0rA	0.042	0.113	4.090E-9	442	0.031	0.118	1w0rA.pdb.gz
11	AFDB:Q28983	0.046	0.033	1.369E-4	2476	0.086	0.059	Q28983.pdb.gz	ZAN_PIG Zonadhesin OS=Sus scrofa OX=9823 GN=ZAN PE=1 SV=1
12	PDB:4a5wB	0.040	0.068	1.504E-4	871	0.017	0.033	4a5wB.pdb.gz	Assembly and Regulation of the Membrane Attack Complex Based on Structures of C5B6 and Sc5B9.
13	PDB:7nycC	0.031	0.059	2.202E-4	809	0.028	0.059	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
14	PDB:7ufgA	0.097	0.131	6.910E-4	1151	0.050	0.074	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
15	PDB:4e0sB	0.035	0.062	1.652E-3	898	0.033	0.062	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
16	PDB:3t5oA	0.033	0.059	4.403E-3	871	0.026	0.051	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
17	AFDB:Q59FP8	0.042	0.052	4.984E-3	1130	0.068	0.102	Q59FP8.pdb.gz	Q59FP8_HUMAN Neogenin 1 (Fragment) OS=Homo sapiens OX=9606 GN=NEO1 PE=1 SV=1
18	PDB:7nydE	0.032	0.103	8.465E-3	484	0.021	0.074	7nydE.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
19	PDB:7nydG	0.041	0.133	2.383E-2	413	0.019	0.077	7nydG.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
20	PDB:3afkA	0.041	0.238	2.963E-2	167	0.012	0.120	3afkA.pdb.gz	Structural insights into the recognition mechanism between an antitumor galectin AAL and the Thomsen-Friedenreich antigen

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3Z1A5	0.0	721	1117	0.244	0.368	D3Z1A5_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 6 OS=Mus musculus OX=10090 GN=Adamts6 PE=4 SV=1
2	D3ZLL7	0.0	620	1221	0.218	0.301	D3ZLL7_RAT ADAM metallopeptidase with thrombospondin type 1 motif, 16 OS=Rattus norvegicus OX=10116 GN=Adamts16 PE=4 SV=3
3	E7FEJ5	0.0	612	1244	0.222	0.301	E7FEJ5_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 18 isoform X1 OS=Danio rerio OX=7955 GN=adamts18 PE=4 SV=1
4	P58397	0.0	1139	1594	0.330	0.349	ATS12_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Homo sapiens OX=9606 GN=ADAMTS12 PE=1 SV=2
5	Q4VC17	0.0	607	1219	0.224	0.310	ATS18_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Mus musculus OX=10090 GN=Adamts18 PE=2 SV=2
6	Q68SA9	0.0	2419	1657	0.721	0.734	ATS7_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 7 OS=Mus musculus OX=10090 GN=Adamts7 PE=1 SV=3
7	Q69Z28	0.0	619	1222	0.218	0.301	ATS16_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Mus musculus OX=10090 GN=Adamts16 PE=2 SV=2
8	Q811B3	0.0	1117	1600	0.321	0.338	ATS12_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Mus musculus OX=10090 GN=Adamts12 PE=2 SV=2
9	Q8TE60	0.0	622	1221	0.222	0.306	ATS18_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Homo sapiens OX=9606 GN=ADAMTS18 PE=1 SV=3
10	Q9H324	0.0	642	1103	0.238	0.364	ATS10_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 10 OS=Homo sapiens OX=9606 GN=ADAMTS10 PE=1 SV=2
11	Q9UKP4	0.0	3425	1686	1.000	1.000	ATS7_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 7 OS=Homo sapiens OX=9606 GN=ADAMTS7 PE=1 SV=2
12	Q9UKP5	0.0	724	1117	0.245	0.370	ATS6_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 6 OS=Homo sapiens OX=9606 GN=ADAMTS6 PE=2 SV=2
13	Q9W493	0.0	590	1023	0.214	0.353	Q9W493_DROME ADAM metallopeptidase with thrombospondin type 1 motif B, isoform B OS=Drosophila melanogaster OX=7227 GN=AdamTS-B PE=4 SV=3
14	D3YX90	8.38e-171	548	1095	0.202	0.311	D3YX90_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 17 OS=Mus musculus OX=10090 GN=Adamts17 PE=1 SV=1
15	E7FFX0	2.18e-167	543	1224	0.190	0.261	E7FFX0_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Danio rerio OX=7955 GN=LOC568792 PE=4 SV=3
16	Q9P2N4	1.50e-158	533	1935	0.206	0.179	ATS9_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 9 OS=Homo sapiens OX=9606 GN=ADAMTS9 PE=1 SV=4
17	P59511	1.62e-157	530	1906	0.212	0.187	ATS20_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Mus musculus OX=10090 GN=Adamts20 PE=2 SV=2
18	E9PUN6	4.99e-156	526	1931	0.205	0.179	E9PUN6_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 OS=Mus musculus OX=10090 GN=Adamts9 PE=1 SV=1
19	P59510	2.63e-153	518	1910	0.199	0.175	ATS20_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Homo sapiens OX=9606 GN=ADAMTS20 PE=2 SV=2
20	B2RY57	2.12e-149	493	1203	0.196	0.274	B2RY57_MOUSE A disintegrin-like and metallopeptidase (Reprolysin type) with thrombospondin type 1 motif, 3 OS=Mus musculus OX=10090 GN=Adamts3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17771 ADAMTS_CR_2	5.6e-17	73.3	ADAMTS cysteine-rich domain 2
2	PF19236 ADAMTS_CR_3	6.9e-06	37.5	ADAMTS cysteine-rich domain
3	PF05986 ADAMTS_spacer1	2.8e-26	103.5	ADAM-TS Spacer 1
4	PF01562 Pep_M12B_propep	5.7e-36	135.3	Reprolysin family propeptide
5	PF08686 PLAC	43	16.3	PLAC (protease and lacunin) domain
6	PF01421 Reprolysin	1.7e-22	91.9	Reprolysin (M12B) family zinc metalloprotease
7	PF13574 Reprolysin_2	0.065	24.7	Metallo-peptidase family M12B Reprolysin-like
8	PF13582 Reprolysin_3	0.00012	34.0	Metallo-peptidase family M12B Reprolysin-like
9	PF13583 Reprolysin_4	0.93	20.6	Metallo-peptidase family M12B Reprolysin-like
10	PF13688 Reprolysin_5	4.3e-10	51.6	Metallo-peptidase family M12
11	PF19030 TSP1_ADAMTS	6e-69	239.5	Thrombospondin type 1 domain
12	PF19035 TSP1_CCN	2.1e-09	48.9	CCN3 Nov like TSP1 domain
13	PF19028 TSP1_spondin	6.4e-08	44.1	Spondin-like TSP1 domain
14	PF00090 TSP_1	2.2e-26	103.1	Thrombospondin type 1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000373472

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000422554	0.944	A disintegrin and metalloproteinase with thrombospondin motifs 12
2	9606.ENSP00000260356	0.935	Thrombospondin-1
3	9606.ENSP00000343002	0.935	Beta-1,3-glucosyltransferase
4	9606.ENSP00000369921	0.932	ADAMTS-like protein 1
5	9606.ENSP00000360997	0.925	A disintegrin and metalloproteinase with thrombospondin motifs 13
6	9606.ENSP00000286744	0.923	ADAMTS-like protein 3
7	9606.ENSP00000286657	0.922	A disintegrin and metalloproteinase with thrombospondin motifs 3
8	9606.ENSP00000284987	0.920	A disintegrin and metalloproteinase with thrombospondin motifs 5
9	9606.ENSP00000299164	0.920	ADAM metallopeptidase with thrombospondin type 1 motif 15
10	9606.ENSP00000339613	0.920	GDP-fucose protein O-fucosyltransferase 2
11	9606.ENSP00000346478	0.920	ADAMTS-like protein 2
12	9606.ENSP00000355751	0.920	Thrombospondin-2
13	9606.ENSP00000362304	0.920	A disintegrin and metalloproteinase with thrombospondin motifs 14
14	9606.ENSP00000418735	0.920	A disintegrin and metalloproteinase with thrombospondin motifs 9
15	9606.ENSP00000251582	0.919	A disintegrin and metalloproteinase with thrombospondin motifs 2
16	9606.ENSP00000274487	0.919	ADAM metallopeptidase with thrombospondin type 1 motif 19
17	9606.ENSP00000284984	0.919	A disintegrin and metalloproteinase with thrombospondin motifs 1
18	9606.ENSP00000358035	0.919	ADAMTS-like protein 4
19	9606.ENSP00000374071	0.919	A disintegrin and metalloproteinase with thrombospondin motifs 20
20	9606.ENSP00000356975	0.917	A disintegrin and metalloproteinase with thrombospondin motifs 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008237	1.000	metallopeptidase activity
GO:0004175	0.997	endopeptidase activity
GO:0004222	0.981	metalloendopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0043170	0.977	macromolecule metabolic process
GO:1901564	0.977	organonitrogen compound metabolic process
GO:0050789	0.974	regulation of biological process
GO:0050794	0.962	regulation of cellular process
GO:0006508	0.935	proteolysis
GO:0050896	0.787	response to stimulus
GO:0048519	0.667	negative regulation of biological process
GO:0051239	0.618	regulation of multicellular organismal process
GO:0032501	0.614	multicellular organismal process
GO:0071840	0.594	cellular component organization or biogenesis
GO:0032502	0.580	developmental process
GO:0042221	0.554	response to chemical
GO:0016043	0.547	cellular component organization
GO:0050793	0.507	regulation of developmental process
GO:0048856	0.483	anatomical structure development
GO:2000026	0.418	regulation of multicellular organismal development
GO:0061035	0.412	regulation of cartilage development
GO:0070555	0.369	response to interleukin-1
GO:0007275	0.356	multicellular organism development
GO:0051716	0.354	cellular response to stimulus
GO:0048523	0.337	negative regulation of cellular process
GO:0048518	0.325	positive regulation of biological process
GO:0030198	0.314	extracellular matrix organization
GO:0048522	0.302	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0012505	0.995	endomembrane system
GO:0070013	0.994	intracellular organelle lumen
GO:0005737	0.992	cytoplasm
GO:0071944	0.972	cell periphery
GO:0005783	0.925	endoplasmic reticulum
GO:0005576	0.897	extracellular region
GO:0005788	0.846	endoplasmic reticulum lumen
GO:0030312	0.840	external encapsulating structure
GO:0031012	0.822	extracellular matrix
GO:0062023	0.377	collagen-containing extracellular matrix
GO:0005615	0.341	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).
EC:3.4.24.-	0.981	Metalloendopeptidases.

[back to server]