StarFunc result for job id Q9UKP5

User Input

>input (1117 residues)
MEILWKTLTWILSLIMASSEFHSDHRLSYSSQEEFLTYLEHYQLTIPIRVDQNGAFLSFT
VKNDKHSRRRRSMDPIDPQQAVSKLFFKLSAYGKHFHLNLTLNTDFVSKHFTVEYWGKDG
PQWKHDFLDNCHYTGYLQDQRSTTKVALSNCVGLHGVIATEDEEYFIEPLKNTTEDSKHF
SYENGHPHVIYKKSALQQRHLYDHSHCGVSDFTRSGKPWWLNDTSTVSYSLPINNTHIHH
RQKRSVSIERFVETLVVADKMMVGYHGRKDIEHYILSVMNIVAKLYRDSSLGNVVNIIVA
RLIVLTEDQPNLEINHHADKSLDSFCKWQKSILSHQSDGNTIPENGIAHHDNAVLITRYD
ICTYKNKPCGTLGLASVAGMCEPERSCSINEDIGLGSAFTIAHEIGHNFGMNHDGIGNSC
GTKGHEAAKLMAAHITANTNPFSWSACSRDYITSFLDSGRGTCLDNEPPKRDFLYPAVAP
GQVYDADEQCRFQYGATSRQCKYGEVCRELWCLSKSNRCVTNSIPAAEGTLCQTGNIEKG
WCYQGDCVPFGTWPQSIDGGWGPWSLWGECSRTCGGGVSSSLRHCDSPAPSGGGKYCLGE
RKRYRSCNTDPCPLGSRDFREKQCADFDNMPFRGKYYNWKPYTGGGVKPCALNCLAEGYN
FYTERAPAVIDGTQCNADSLDICINGECKHVGCDNILGSDAREDRCRVCGGDGSTCDAIE
GFFNDSLPRGGYMEVVQIPRGSVHIEVREVAMSKNYIALKSEGDDYYINGAWTIDWPRKF
DVAGTAFHYKRPTDEPESLEALGPTSENLIVMVLLQEQNLGIRYKFNVPITRTGSGDNEV
GFTWNHQPWSECSATCAGGVQRQEVVCKRLDDNSIVQNNYCDPDSKPPENQRACNTEPCP
PEWFIGDWLECSKTCDGGMRTRAVLCIRKIGPSEEETLDYSGCLTHRPVEKEPCNNQSCP
PQWVALDWSECTPKCGPGFKHRIVLCKSSDLSKTFPAAQCPEESKPPVRIRCSLGRCPPP
RWVTGDWGQCSAQCGLGQQMRTVQCLSYTGQASSDCLETVRPPSMQQCESKCDSTPISNT
EECKDVNKVAYCPLVLKFKFCSRAYFRQMCCKTCQGH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3Z1A5	0.793	0.793	0.000	1117	0.959	0.959	D3Z1A5.pdb.gz	D3Z1A5_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 6 OS=Mus musculus OX=10090 GN=Adamts6 PE=4 SV=1
2	AFDB:E7FEJ5	0.475	0.431	0.000	1244	0.394	0.354	E7FEJ5.pdb.gz	E7FEJ5_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 18 isoform X1 OS=Danio rerio OX=7955 GN=adamts18 PE=4 SV=1
3	AFDB:E7FFX0	0.508	0.467	0.000	1224	0.379	0.346	E7FFX0.pdb.gz	E7FFX0_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Danio rerio OX=7955 GN=LOC568792 PE=4 SV=3
4	AFDB:P58397	0.622	0.444	0.000	1594	0.359	0.252	P58397.pdb.gz	ATS12_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Homo sapiens OX=9606 GN=ADAMTS12 PE=1 SV=2
5	AFDB:Q4VC17	0.552	0.510	0.000	1219	0.385	0.353	Q4VC17.pdb.gz	ATS18_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Mus musculus OX=10090 GN=Adamts18 PE=2 SV=2
6	AFDB:Q68SA9	0.571	0.395	0.000	1657	0.353	0.238	Q68SA9.pdb.gz	ATS7_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 7 OS=Mus musculus OX=10090 GN=Adamts7 PE=1 SV=3
7	AFDB:Q69Z28	0.495	0.458	0.000	1222	0.372	0.340	Q69Z28.pdb.gz	ATS16_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Mus musculus OX=10090 GN=Adamts16 PE=2 SV=2
8	AFDB:Q811B3	0.606	0.431	0.000	1600	0.363	0.253	Q811B3.pdb.gz	ATS12_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Mus musculus OX=10090 GN=Adamts12 PE=2 SV=2
9	AFDB:Q8TE60	0.519	0.479	0.000	1221	0.392	0.359	Q8TE60.pdb.gz	ATS18_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Homo sapiens OX=9606 GN=ADAMTS18 PE=1 SV=3
10	AFDB:Q9H324	0.680	0.689	0.000	1103	0.594	0.602	Q9H324.pdb.gz	ATS10_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 10 OS=Homo sapiens OX=9606 GN=ADAMTS10 PE=1 SV=2
11	PDB:4q1lA	0.162	0.830	8.729E-13	202	0.054	0.297	4q1lA.pdb.gz	Complete amino-acid sequence, crystallization and preliminary X-ray diffraction studies of leucurolysin-a, a nonhaemorrhagic metalloproteinase from Bothrops leucurus snake venom.
12	PDB:1w0rA	0.078	0.170	2.852E-8	442	0.057	0.145	1w0rA.pdb.gz
13	PDB:7ufgA	0.129	0.126	1.536E-5	1151	0.101	0.098	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
14	PDB:2x7mA	0.120	0.578	1.767E-4	180	0.026	0.161	2x7mA.pdb.gz	Crystal Structure of Archaemetzincin Amza from Methanopyrus Kandleri at 1.5A Resolution.
15	PDB:7nycC	0.043	0.059	1.034E-3	809	0.045	0.062	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
16	PDB:3t5oA	0.058	0.070	1.488E-3	871	0.018	0.023	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
17	PDB:4a5wB	0.056	0.068	1.488E-3	871	0.029	0.037	4a5wB.pdb.gz	Assembly and Regulation of the Membrane Attack Complex Based on Structures of C5B6 and Sc5B9.
18	PDB:7nycD	0.053	0.105	2.375E-3	487	0.062	0.142	7nycD.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
19	PDB:7nydE	0.060	0.119	2.776E-3	484	0.056	0.128	7nydE.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
20	PDB:4e0sB	0.048	0.059	6.054E-3	898	0.045	0.056	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A286YCD8	0.0	546	292	0.232	0.887	A0A286YCD8_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 6 OS=Mus musculus OX=10090 GN=Adamts6 PE=4 SV=1
2	A0A286YEC9	0.0	908	468	0.388	0.925	A0A286YEC9_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 6 OS=Mus musculus OX=10090 GN=Adamts6 PE=4 SV=1
3	D3Z1A5	0.0	2255	1117	0.960	0.960	D3Z1A5_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 6 OS=Mus musculus OX=10090 GN=Adamts6 PE=4 SV=1
4	D3ZLL7	0.0	731	1221	0.372	0.341	D3ZLL7_RAT ADAM metallopeptidase with thrombospondin type 1 motif, 16 OS=Rattus norvegicus OX=10116 GN=Adamts16 PE=4 SV=3
5	E7FEJ5	0.0	751	1244	0.372	0.334	E7FEJ5_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 18 isoform X1 OS=Danio rerio OX=7955 GN=adamts18 PE=4 SV=1
6	E7FFX0	0.0	661	1224	0.356	0.325	E7FFX0_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Danio rerio OX=7955 GN=LOC568792 PE=4 SV=3
7	E9PUN6	0.0	614	1931	0.360	0.208	E9PUN6_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 OS=Mus musculus OX=10090 GN=Adamts9 PE=1 SV=1
8	P58397	0.0	689	1594	0.356	0.250	ATS12_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Homo sapiens OX=9606 GN=ADAMTS12 PE=1 SV=2
9	P59510	0.0	588	1910	0.349	0.204	ATS20_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Homo sapiens OX=9606 GN=ADAMTS20 PE=2 SV=2
10	P59511	0.0	603	1906	0.345	0.202	ATS20_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Mus musculus OX=10090 GN=Adamts20 PE=2 SV=2
11	Q4VC17	0.0	758	1219	0.378	0.346	ATS18_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Mus musculus OX=10090 GN=Adamts18 PE=2 SV=2
12	Q68SA9	0.0	691	1657	0.355	0.239	ATS7_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 7 OS=Mus musculus OX=10090 GN=Adamts7 PE=1 SV=3
13	Q69Z28	0.0	707	1222	0.363	0.332	ATS16_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Mus musculus OX=10090 GN=Adamts16 PE=2 SV=2
14	Q811B3	0.0	693	1600	0.363	0.254	ATS12_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Mus musculus OX=10090 GN=Adamts12 PE=2 SV=2
15	Q8TE60	0.0	775	1221	0.374	0.342	ATS18_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Homo sapiens OX=9606 GN=ADAMTS18 PE=1 SV=3
16	Q9H324	0.0	1406	1103	0.600	0.607	ATS10_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 10 OS=Homo sapiens OX=9606 GN=ADAMTS10 PE=1 SV=2
17	Q9P2N4	0.0	617	1935	0.367	0.212	ATS9_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 9 OS=Homo sapiens OX=9606 GN=ADAMTS9 PE=1 SV=4
18	Q9UKP4	0.0	723	1686	0.370	0.245	ATS7_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 7 OS=Homo sapiens OX=9606 GN=ADAMTS7 PE=1 SV=2
19	Q9UKP5	0.0	2337	1117	1.000	1.000	ATS6_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 6 OS=Homo sapiens OX=9606 GN=ADAMTS6 PE=2 SV=2
20	Q8C9R1	3.47e-177	523	310	0.221	0.797	Q8C9R1_MOUSE PLAC domain-containing protein OS=Mus musculus OX=10090 GN=Adamts6 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17771 ADAMTS_CR_2	3.8e-14	64.3	ADAMTS cysteine-rich domain 2
2	PF19236 ADAMTS_CR_3	2.6e-07	42.0	ADAMTS cysteine-rich domain
3	PF05986 ADAMTS_spacer1	3.3e-28	109.7	ADAM-TS Spacer 1
4	PF00781 DAGK_cat	6.8e+02	11.3	Diacylglycerol kinase catalytic domain
5	PF12388 Peptidase_M57	1.7e+02	13.3	Dual-action HEIGH metallo-peptidase
6	PF10462 Peptidase_M66	4.6e+02	11.1	Peptidase M66
7	PF01562 Pep_M12B_propep	5.2e-38	141.9	Reprolysin family propeptide
8	PF08686 PLAC	7.1e-06	38.0	PLAC (protease and lacunin) domain
9	PF01421 Reprolysin	4.1e-22	90.7	Reprolysin (M12B) family zinc metalloprotease
10	PF13574 Reprolysin_2	1.3e-05	36.7	Metallo-peptidase family M12B Reprolysin-like
11	PF13582 Reprolysin_3	5.9e-09	47.9	Metallo-peptidase family M12B Reprolysin-like
12	PF13583 Reprolysin_4	0.0055	27.9	Metallo-peptidase family M12B Reprolysin-like
13	PF13688 Reprolysin_5	1.7e-11	56.2	Metallo-peptidase family M12
14	PF19030 TSP1_ADAMTS	2.8e-44	160.5	Thrombospondin type 1 domain
15	PF19035 TSP1_CCN	1.8	20.2	CCN3 Nov like TSP1 domain
16	PF19028 TSP1_spondin	0.00012	33.7	Spondin-like TSP1 domain
17	PF00090 TSP_1	5.6e-15	66.6	Thrombospondin type 1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370443

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369921	0.922	ADAMTS-like protein 1
2	9606.ENSP00000346478	0.921	ADAMTS-like protein 2
3	9606.ENSP00000358035	0.921	ADAMTS-like protein 4
4	9606.ENSP00000247153	0.920	Properdin
5	9606.ENSP00000260356	0.920	Thrombospondin-1
6	9606.ENSP00000360997	0.920	A disintegrin and metalloproteinase with thrombospondin motifs 13
7	9606.ENSP00000339613	0.917	GDP-fucose protein O-fucosyltransferase 2
8	9606.ENSP00000347484	0.917	Thrombospondin type-1 domain-containing protein 4
9	9606.ENSP00000284984	0.916	A disintegrin and metalloproteinase with thrombospondin motifs 1
10	9606.ENSP00000284987	0.915	A disintegrin and metalloproteinase with thrombospondin motifs 5
11	9606.ENSP00000286657	0.915	A disintegrin and metalloproteinase with thrombospondin motifs 3
12	9606.ENSP00000268070	0.914	ADAM metallopeptidase with thrombospondin type 1 motif 17
13	9606.ENSP00000286744	0.914	ADAMTS-like protein 3
14	9606.ENSP00000299164	0.914	ADAM metallopeptidase with thrombospondin type 1 motif 15
15	9606.ENSP00000356975	0.914	A disintegrin and metalloproteinase with thrombospondin motifs 4
16	9606.ENSP00000251582	0.913	A disintegrin and metalloproteinase with thrombospondin motifs 2
17	9606.ENSP00000274487	0.913	ADAM metallopeptidase with thrombospondin type 1 motif 19
18	9606.ENSP00000343002	0.913	Beta-1,3-glucosyltransferase
19	9606.ENSP00000362304	0.913	A disintegrin and metalloproteinase with thrombospondin motifs 14
20	9606.ENSP00000418735	0.913	A disintegrin and metalloproteinase with thrombospondin motifs 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008237	1.000	metallopeptidase activity
GO:0005488	0.998	binding
GO:0005515	0.992	protein binding
GO:0004175	0.888	endopeptidase activity
GO:0004222	0.872	metalloendopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.969	multicellular organismal process
GO:0032502	0.944	developmental process
GO:0048731	0.898	system development
GO:0009987	0.859	cellular process
GO:0048513	0.756	animal organ development
GO:0071704	0.622	organic substance metabolic process
GO:0044238	0.620	primary metabolic process
GO:0006807	0.612	nitrogen compound metabolic process
GO:0065007	0.601	biological regulation
GO:0001822	0.573	kidney development
GO:0043170	0.571	macromolecule metabolic process
GO:0003205	0.565	cardiac chamber development
GO:0060840	0.557	artery development
GO:0050789	0.556	regulation of biological process
GO:1901564	0.551	organonitrogen compound metabolic process
GO:0060976	0.535	coronary vasculature development
GO:0019538	0.521	protein metabolic process
GO:0050794	0.484	regulation of cellular process
GO:0035904	0.458	aorta development
GO:0003279	0.421	cardiac septum development
GO:0071840	0.333	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.997	cell periphery
GO:0031012	0.993	extracellular matrix
GO:0005576	0.932	extracellular region
GO:0062023	0.866	collagen-containing extracellular matrix
GO:0043227	0.832	membrane-bounded organelle
GO:0043231	0.783	intracellular membrane-bounded organelle
GO:0005737	0.530	cytoplasm
GO:0009986	0.399	cell surface

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).
EC:3.4.24.-	0.872	Metalloendopeptidases.

[back to server]