StarFunc result for job id Q9UKS7

User Input

>input (526 residues)
METEAIDGYITCDNELSPEREHSNMAIDLTSSTPNGQHASPSHMTSTNSVKLEMQSDEEC
DRKPLSREDEIRGHDEGSSLEEPLIESSEVADNRKVQELQGEGGIRLPNGKLKCDVCGMV
CIGPNVLMVHKRSHTGERPFHCNQCGASFTQKGNLLRHIKLHSGEKPFKCPFCSYACRRR
DALTGHLRTHSVGKPHKCNYCGRSYKQRSSLEEHKERCHNYLQNVSMEAAGQVMSHHVPP
MEDCKEQEPIMDNNISLVPFERPAVIEKLTGNMGKRKSSTPQKFVGEKLMRFSYPDIHFD
MNLTYEKEAELMQSHMMDQAINNAITYLGAEALHPLMQHPPSTIAEVAPVISSAYSQVYH
PNRIERPISRETADSHENNMDGPISLIRPKSRPQEREASPSNSCLDSTDSESSHDDHQSY
QGHPALNPKRKQSPAYMKEDVKALDTTKAPKGSLKDIYKVFNGEGEQIRAFKCEHCRVLF
LDHVMYTIHMGCHGYRDPLECNICGYRSQDRYEFSSHIVRGEHTFH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P81183	0.439	0.439	1.378E-79	526	0.979	0.979	P81183.pdb.gz	IKZF2_MOUSE Zinc finger protein Helios OS=Mus musculus OX=10090 GN=Ikzf2 PE=1 SV=2
2	AFDB:Q6DBW0	0.202	0.247	3.532E-17	419	0.200	0.251	Q6DBW0.pdb.gz	IKZF5_DANRE Zinc finger protein Pegasus OS=Danio rerio OX=7955 GN=ikzf5 PE=2 SV=1
3	AFDB:A1Z9R4	0.137	0.074	1.434E-12	1228	0.213	0.091	A1Z9R4.pdb.gz	ZN423_DROME Zinc finger protein 423 homolog OS=Drosophila melanogaster OX=7227 GN=Oaz PE=2 SV=2
4	AFDB:Q96BV0	0.208	0.204	1.851E-12	537	0.209	0.205	Q96BV0.pdb.gz	ZN775_HUMAN Zinc finger protein 775 OS=Homo sapiens OX=9606 GN=ZNF775 PE=1 SV=2
5	AFDB:Q9VI93	0.166	0.097	6.237E-12	946	0.184	0.103	Q9VI93.pdb.gz	RN_DROME Zinc finger protein rotund OS=Drosophila melanogaster OX=7227 GN=rn PE=1 SV=2
6	AFDB:Q9VQU9	0.167	0.122	1.260E-11	744	0.169	0.120	Q9VQU9.pdb.gz	BOWEL_DROME Protein bowel OS=Drosophila melanogaster OX=7227 GN=bowl PE=1 SV=1
7	AFDB:Q02975	0.160	0.147	1.849E-11	576	0.116	0.106	Q02975.pdb.gz	Z354A_RAT Zinc finger protein 354A OS=Rattus norvegicus OX=10116 GN=Znf354a PE=2 SV=1
8	AFDB:G5EGB2	0.192	0.217	7.078E-11	459	0.163	0.187	G5EGB2.pdb.gz	LIN29_CAEEL Zinc finger transcription factor lin-29 OS=Caenorhabditis elegans OX=6239 GN=lin-29 PE=1 SV=1
9	AFDB:A1YPR0	0.165	0.142	4.817E-10	619	0.156	0.132	A1YPR0.pdb.gz	ZBT7C_HUMAN Zinc finger and BTB domain-containing protein 7C OS=Homo sapiens OX=9606 GN=ZBTB7C PE=2 SV=1
10	AFDB:Q8CCE9	0.181	0.129	6.631E-10	783	0.163	0.110	Q8CCE9.pdb.gz	E4F1_MOUSE Transcription factor E4F1 OS=Mus musculus OX=10090 GN=E4f1 PE=1 SV=2
11	PDB:3w5kB	0.090	0.268	4.401E-5	110	0.074	0.355	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6hlqI	0.032	0.126	5.653E-1	111	0.040	0.189	6hlqI.pdb.gz	The cryo-EM structure of a 12-subunit variant of RNA polymerase I reveals dissociation of the A49-A34.5 heterodimer and rearrangement of subunit A12.2.
13	PDB:6o9lQ	0.055	0.064	6.026E-1	430	0.072	0.088	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
14	PDB:5dkaA	0.056	0.237	6.424E-1	96	0.029	0.156	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
15	PDB:7pmkQ	0.039	0.033	6.848E-1	766	0.038	0.026	7pmkQ.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
16	PDB:3j6bW	0.059	0.170	1.572	112	0.042	0.196	3j6bW.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
17	PDB:5n5yI	0.034	0.138	2.307	99	0.032	0.172	5n5yI.pdb.gz	Structural Basis of RNA Polymerase I Transcription Initiation.
18	PDB:6ff79	0.053	0.061	2.795	432	0.029	0.035	6ff79.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
19	PDB:7vo0G	0.049	0.123	3.176	131	0.036	0.145	7vo0G.pdb.gz	Structural basis of Streptomyces transcription activation by zinc uptake regulator.
20	PDB:4btsA9	0.044	0.164	3.847	93	0.029	0.161	4btsA9.pdb.gz	The crystal structure of the eukaryotic 40S ribosomal subunit in complex with eIF1 and eIF1A.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F8VPL6	0.0	546	540	0.559	0.544	F8VPL6_HUMAN IKAROS family zinc finger 4 OS=Homo sapiens OX=9606 GN=IKZF4 PE=1 SV=1
2	P81183	0.0	1078	526	0.979	0.979	IKZF2_MOUSE Zinc finger protein Helios OS=Mus musculus OX=10090 GN=Ikzf2 PE=1 SV=2
3	Q13422	0.0	520	519	0.529	0.536	IKZF1_HUMAN DNA-binding protein Ikaros OS=Homo sapiens OX=9606 GN=IKZF1 PE=1 SV=1
4	Q8C208	0.0	538	586	0.548	0.491	IKZF4_MOUSE Zinc finger protein Eos OS=Mus musculus OX=10090 GN=Ikzf4 PE=1 SV=2
5	Q90W82	0.0	968	563	0.892	0.833	Q90W82_CHICK IKAROS family zinc finger 2 OS=Gallus gallus OX=9031 GN=HELIOS PE=2 SV=1
6	Q9H2S9	0.0	544	585	0.557	0.501	IKZF4_HUMAN Zinc finger protein Eos OS=Homo sapiens OX=9606 GN=IKZF4 PE=1 SV=2
7	Q9UKS7	0.0	1097	526	1.000	1.000	IKZF2_HUMAN Zinc finger protein Helios OS=Homo sapiens OX=9606 GN=IKZF2 PE=1 SV=2
8	O42410	3.66e-180	518	518	0.521	0.529	IKZF1_CHICK DNA-binding protein Ikaros OS=Gallus gallus OX=9031 GN=IKZF1 PE=2 SV=1
9	Q03267	7.32e-173	499	517	0.521	0.530	IKZF1_MOUSE DNA-binding protein Ikaros OS=Mus musculus OX=10090 GN=Ikzf1 PE=1 SV=2
10	O08900	2.65e-157	459	507	0.473	0.491	IKZF3_MOUSE Zinc finger protein Aiolos OS=Mus musculus OX=10090 GN=Ikzf3 PE=1 SV=2
11	Q9UKT9	2.36e-153	449	509	0.437	0.452	IKZF3_HUMAN Zinc finger protein Aiolos OS=Homo sapiens OX=9606 GN=IKZF3 PE=1 SV=2
12	O93581	1.16e-151	446	537	0.489	0.479	O93581_DANRE DNA-binding protein Ikaros OS=Danio rerio OX=7955 GN=znfn1a1 PE=2 SV=1
13	Q5SWU0	3.05e-147	431	428	0.428	0.526	Q5SWU0_MOUSE IKAROS family zinc finger 1 OS=Mus musculus OX=10090 GN=Ikzf1 PE=1 SV=1
14	A0A087WU46	3.41e-106	323	336	0.327	0.512	A0A087WU46_HUMAN IKAROS family zinc finger 1 OS=Homo sapiens OX=9606 GN=IKZF1 PE=1 SV=1
15	A0A0A0MRA0	2.93e-73	234	249	0.234	0.494	A0A0A0MRA0_HUMAN IKAROS family zinc finger 1 OS=Homo sapiens OX=9606 GN=IKZF1 PE=1 SV=1
16	R9R4D9	3.76e-48	169	268	0.163	0.321	R9R4D9_HUMAN IKAROS family zinc finger 1 isoform 14 OS=Homo sapiens OX=9606 GN=IKZF1 PE=1 SV=1
17	Q9H5V7	3.62e-32	130	419	0.230	0.289	IKZF5_HUMAN Zinc finger protein Pegasus OS=Homo sapiens OX=9606 GN=IKZF5 PE=1 SV=1
18	Q6DBW0	3.29e-28	119	419	0.211	0.265	IKZF5_DANRE Zinc finger protein Pegasus OS=Danio rerio OX=7955 GN=ikzf5 PE=2 SV=1
19	Q8NDW4	2.27e-24	108	579	0.099	0.090	ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens OX=9606 GN=ZNF248 PE=1 SV=1
20	Q15776	6.42e-24	107	578	0.089	0.081	ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens OX=9606 GN=ZKSCAN8 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09237 GAGA	83	14.6	GAGA factor
2	PF00096 zf-C2H2	2.9e-12	57.5	Zinc finger, C2H2 type
3	PF13894 zf-C2H2_4	7.4e-08	43.6	C2H2-type zinc finger
4	PF13465 zf-H2C2_2	2.8e-16	70.3	Zinc-finger double domain
5	PF13909 zf-H2C2_5	0.089	23.9	C2H2-type zinc-finger domain
6	PF12874 zf-met	7.9e+02	11.9	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000412869

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365380	0.729	Forkhead box protein P3
2	9606.ENSP00000357881	0.695	Zinc finger protein Pegasus
3	9606.ENSP00000331614	0.693	DNA-binding protein Ikaros
4	9606.ENSP00000373325	0.641	Interleukin-17 receptor E
5	9606.ENSP00000334941	0.636	Receptor-type tyrosine-protein phosphatase U
6	9606.ENSP00000349508	0.595	Chromodomain-helicase-DNA-binding protein 4
7	9606.ENSP00000261523	0.587	Nuclear receptor ROR-alpha
8	9606.ENSP00000258613	0.550	Thrombospondin type-1 domain-containing protein 1
9	9606.ENSP00000267970	0.543	Tetraspanin-3
10	9606.ENSP00000379739	0.524	Actin-binding protein IPP
11	9606.ENSP00000351990	0.522	NEDD8-activating enzyme E1 regulatory subunit
12	9606.ENSP00000327025	0.509	Nuclear receptor ROR-gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.990	identical protein binding
GO:0140110	0.868	transcription regulator activity
GO:0003700	0.855	DNA-binding transcription factor activity
GO:1990837	0.855	sequence-specific double-stranded DNA binding
GO:0000981	0.792	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001067	0.764	transcription regulatory region nucleic acid binding
GO:0000976	0.726	transcription cis-regulatory region binding
GO:0000977	0.520	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0008134	0.448	transcription factor binding
GO:0000978	0.341	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0080090	0.980	regulation of primary metabolic process
GO:0051171	0.965	regulation of nitrogen compound metabolic process
GO:0031323	0.963	regulation of cellular metabolic process
GO:0009987	0.951	cellular process
GO:0010468	0.915	regulation of gene expression
GO:0048522	0.914	positive regulation of cellular process
GO:0006355	0.864	regulation of DNA-templated transcription
GO:0051173	0.763	positive regulation of nitrogen compound metabolic process
GO:0010557	0.762	positive regulation of macromolecule biosynthetic process
GO:0031325	0.746	positive regulation of cellular metabolic process
GO:0006357	0.675	regulation of transcription by RNA polymerase II
GO:0031328	0.668	positive regulation of cellular biosynthetic process
GO:0045893	0.580	positive regulation of DNA-templated transcription
GO:0048519	0.422	negative regulation of biological process
GO:0045944	0.391	positive regulation of transcription by RNA polymerase II
GO:0048523	0.367	negative regulation of cellular process
GO:0050896	0.359	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.986	nuclear lumen
GO:0005654	0.984	nucleoplasm
GO:0005737	0.944	cytoplasm
GO:0032991	0.356	protein-containing complex
GO:0005829	0.345	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]