StarFunc result for job id Q9UKT4

User Input

>input (447 residues)
MSRRPCSCALRPPRCSCSASPSAVTAAGRPRPSDSCKEESSTLSVKMKCDFNCNHVHSGL
KLVKPDDIGRLVSYTPAYLEGSCKDCIKDYERLSCIGSPIVSPRIVQLETESKRLHNKEN
QHVQQTLNSTNEIEALETSRLYEDSGYSSFSLQSGLSEHEEGSLLEENFGDSLQSCLLQI
QSPDQYPNKNLLPVLHFEKVVCSTLKKNAKRNPKVDREMLKEIIARGNFRLQNIIGRKMG
LECVDILSELFRRGLRHVLATILAQLSDMDLINVSKVSTTWKKILEDDKGAFQLYSKAIQ
RVTENNNKFSPHASTREYVMFRTPLASVQKSAAQTSLKKDAQTKLSNQGDQKGSTYSRHN
EFSEVAKTLKKNESLKACIRCNSPAKYDCYLQRATCKREGCGFDYCTKCLCNYHTTKDCS
DGKLLKASCKIGPLPGTKKSKKNLRRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UKT4	1.000	1.000	1.903E-72	447	1.000	1.000	Q9UKT4.pdb.gz	FBX5_HUMAN F-box only protein 5 OS=Homo sapiens OX=9606 GN=FBXO5 PE=1 SV=1
2	PDB:7qe7S	0.141	0.604	4.732E-12	100	0.221	0.990	7qe7S.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
3	PDB:4ui9S	0.137	0.607	3.812E-9	94	0.204	0.968	4ui9S.pdb.gz	Atomic Structure of the Apc and its Mechanism of Protein Ubiquitination
4	AFDB:Q2R3F6	0.093	0.082	2.675E-2	524	0.114	0.097	Q2R3F6.pdb.gz	Q2R3F6_ORYSJ Helix-loop-helix DNA-binding domain containing protein, expressed OS=Oryza sativa subsp. japonica OX=39947 GN=LOC_Os11g32100 PE=3 SV=1
5	AFDB:Q6YW41	0.077	0.053	3.636E-2	745	0.128	0.077	Q6YW41.pdb.gz	Q6YW41_ORYSJ Basic helix-loop-helix (BHLH) family protein-like OS=Oryza sativa subsp. japonica OX=39947 GN=B1131G07.17 PE=3 SV=1
6	AFDB:B7ZQA9	0.079	0.079	5.588E-2	445	0.123	0.124	B7ZQA9.pdb.gz	P5F12_XENLA POU domain, class 5, transcription factor 1.2 OS=Xenopus laevis OX=8355 GN=pou5f1.2 PE=1 SV=1
7	AFDB:Q9UKI9	0.095	0.096	8.077E-2	436	0.103	0.106	Q9UKI9.pdb.gz	PO2F3_HUMAN POU domain, class 2, transcription factor 3 OS=Homo sapiens OX=9606 GN=POU2F3 PE=1 SV=3
8	AFDB:P07834	0.115	0.076	9.132E-2	779	0.130	0.074	P07834.pdb.gz	CDC4_YEAST Cell division control protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC4 PE=1 SV=2
9	AFDB:A0A140VJR0	0.102	0.069	9.710E-2	809	0.139	0.077	A0A140VJR0.pdb.gz	A0A140VJR0_HUMAN Phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE4D PE=2 SV=1
10	AFDB:Q9LSE2	0.085	0.079	1.032E-1	494	0.132	0.119	Q9LSE2.pdb.gz	ICE1_ARATH Transcription factor ICE1 OS=Arabidopsis thaliana OX=3702 GN=SCRM PE=1 SV=1
11	AFDB:Q9USU1	0.082	0.045	1.241E-1	987	0.136	0.062	Q9USU1.pdb.gz	EFC25_SCHPO Ras guanine nucleotide exchange factor efc25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=efc25 PE=1 SV=1
12	AFDB:Q7M3S9	0.066	0.042	1.320E-1	943	0.112	0.053	Q7M3S9.pdb.gz	RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum OX=44689 GN=rngB PE=2 SV=2
13	PDB:6ttuT	0.108	0.122	5.840E-1	394	0.038	0.043	6ttuT.pdb.gz	NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.
14	PDB:3ug7A	0.079	0.108	9.543E-1	317	0.045	0.063	3ug7A.pdb.gz	Tail-anchor targeting by a Get3 tetramer: the structure of an archaeal homologue.
15	PDB:4kblA	0.085	0.096	1.015	395	0.020	0.023	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
16	PDB:3j7aU	0.063	0.139	1.560	149	0.049	0.148	3j7aU.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
17	PDB:5tteB	0.084	0.085	1.763	442	0.020	0.020	5tteB.pdb.gz	Structural insights into the mechanism and E2 specificity of the RBR E3 ubiquitin ligase HHARI.
18	PDB:6dv9F	0.082	0.193	1.875	174	0.069	0.178	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.
19	PDB:6ke6A8	0.087	0.073	1.994	548	0.051	0.042	6ke6A8.pdb.gz	3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome
20	PDB:6o60C	0.064	0.073	1.994	389	0.013	0.015	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7TSG3	0.0	535	421	0.633	0.672	FBX5_MOUSE F-box only protein 5 OS=Mus musculus OX=10090 GN=Fbxo5 PE=1 SV=1
2	Q9UKT4	0.0	922	447	1.000	1.000	FBX5_HUMAN F-box only protein 5 OS=Homo sapiens OX=9606 GN=FBXO5 PE=1 SV=1
3	Q90Z80	2.62e-74	240	392	0.338	0.385	FBX5A_XENLA F-box only protein 5-A OS=Xenopus laevis OX=8355 GN=fbxo5-a PE=1 SV=1
4	Q0V967	1.44e-52	183	384	0.264	0.307	FBX5_DANRE F-box only protein 5 OS=Danio rerio OX=7955 GN=fbxo5 PE=1 SV=2
5	Q8AXF4	4.58e-40	154	651	0.233	0.160	FBX43_XENLA F-box only protein 43 OS=Xenopus laevis OX=8355 GN=fbxo43 PE=1 SV=1
6	Q4G163	3.01e-38	149	708	0.199	0.126	FBX43_HUMAN F-box only protein 43 OS=Homo sapiens OX=9606 GN=FBXO43 PE=1 SV=3
7	Q8CDI2	8.85e-35	139	640	0.208	0.145	FBX43_MOUSE F-box only protein 43 OS=Mus musculus OX=10090 GN=Fbxo43 PE=1 SV=2
8	Q7KTX7	0.034	38.9	482	0.054	0.050	PRKN_DROME E3 ubiquitin-protein ligase parkin OS=Drosophila melanogaster OX=7227 GN=park PE=1 SV=1
9	F4IHY7	0.69	34.7	527	0.049	0.042	PTA12_ARATH Protein PLASTID TRANSCRIPTIONALLY ACTIVE 12, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PTAC12 PE=1 SV=1
10	Q9JK66	0.92	34.3	465	0.049	0.047	PRKN_RAT E3 ubiquitin-protein ligase parkin OS=Rattus norvegicus OX=10116 GN=Prkn PE=1 SV=1
11	Q38C52	1.9	33.5	806	0.083	0.046	Q38C52_TRYB2 DNA topoisomerase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.5940 PE=3 SV=1
12	Q9WVS6	2.2	33.1	464	0.049	0.047	PRKN_MOUSE E3 ubiquitin-protein ligase parkin OS=Mus musculus OX=10090 GN=Prkn PE=1 SV=1
13	Q8IWZ5	3.3	32.7	723	0.083	0.051	TRI42_HUMAN Tripartite motif-containing protein 42 OS=Homo sapiens OX=9606 GN=TRIM42 PE=1 SV=2
14	Q7XHZ0	4.3	32.0	310	0.043	0.061	HFB4B_ORYSJ Heat stress transcription factor B-4b OS=Oryza sativa subsp. japonica OX=39947 GN=HSFB4B PE=1 SV=1
15	O75844	4.5	32.0	475	0.047	0.044	FACE1_HUMAN CAAX prenyl protease 1 homolog OS=Homo sapiens OX=9606 GN=ZMPSTE24 PE=1 SV=2
16	Q54MH8	7.2	31.6	808	0.054	0.030	DLPB_DICDI Dynamin-like protein B OS=Dictyostelium discoideum OX=44689 GN=dlpB PE=2 SV=1
17	P22894	7.8	31.2	467	0.034	0.032	MMP8_HUMAN Neutrophil collagenase OS=Homo sapiens OX=9606 GN=MMP8 PE=1 SV=1
18	Q8B9I6	7.9	31.6	810	0.049	0.027	Q8B9I6_NPVR1 Viral desmoplakin N-terminal domain-containing protein OS=Rachiplusia ou multiple nucleopolyhedrovirus (strain R1) OX=654904 PE=4 SV=1
19	Q9Y297	7.9	31.6	605	0.043	0.031	FBW1A_HUMAN F-box/WD repeat-containing protein 1A OS=Homo sapiens OX=9606 GN=BTRC PE=1 SV=1
20	A0A0S2Z507	8.0	31.6	636	0.043	0.030	A0A0S2Z507_HUMAN Beta-transducin repeat containing isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=BTRC PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00646 F-box	0.016	26.3	F-box domain
2	PF12937 F-box-like	9.7	17.5	F-box-like
3	PF01485 IBR	30	16.1	IBR domain, a half RING-finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000229758

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361540	0.999	Cell division cycle protein 20 homolog
2	9606.ENSP00000300093	0.996	Serine/threonine-protein kinase PLK1
3	9606.ENSP00000378529	0.996	Fizzy-related protein homolog
4	9606.ENSP00000378699	0.993	Cyclin-dependent kinase 1
5	9606.ENSP00000231487	0.989	S-phase kinase-associated protein 1
6	9606.ENSP00000256442	0.989	G2/mitotic-specific cyclin-B1
7	9606.ENSP00000434614	0.989	Cell division cycle protein 27 homolog
8	9606.ENSP00000353549	0.986	Cell division cycle protein 16 homolog
9	9606.ENSP00000378350	0.986	Cell division cycle protein 23 homolog
10	9606.ENSP00000274026	0.985	Cyclin-A2
11	9606.ENSP00000359206	0.985	F-box/WD repeat-containing protein 1A
12	9606.ENSP00000314004	0.981	Anaphase-promoting complex subunit 2
13	9606.ENSP00000363322	0.970	Anaphase-promoting complex subunit CDC26
14	9606.ENSP00000421842	0.959	Anaphase-promoting complex subunit 13
15	9606.ENSP00000326804	0.956	Cullin-1
16	9606.ENSP00000209728	0.952	Cell division control protein 6 homolog
17	9606.ENSP00000265094	0.950	F-box/WD repeat-containing protein 11
18	9606.ENSP00000216911	0.945	Aurora kinase A
19	9606.ENSP00000426654	0.941	Anaphase-promoting complex subunit 4
20	9606.ENSP00000478501	0.941	Anaphase-promoting complex subunit 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.976	enzyme binding
GO:0019900	0.965	kinase binding
GO:0055106	0.962	ubiquitin-protein transferase regulator activity
GO:0019901	0.959	protein kinase binding
GO:0004857	0.955	enzyme inhibitor activity
GO:0044877	0.910	protein-containing complex binding
GO:1990948	0.878	ubiquitin ligase inhibitor activity
GO:0010997	0.870	anaphase-promoting complex binding
GO:0003824	0.491	catalytic activity
GO:0140096	0.453	catalytic activity, acting on a protein
GO:0016740	0.441	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:1901987	0.983	regulation of cell cycle phase transition
GO:0007346	0.974	regulation of mitotic cell cycle
GO:0065009	0.956	regulation of molecular function
GO:0051783	0.956	regulation of nuclear division
GO:0031323	0.947	regulation of cellular metabolic process
GO:0051784	0.939	negative regulation of nuclear division
GO:1901990	0.936	regulation of mitotic cell cycle phase transition
GO:1901988	0.935	negative regulation of cell cycle phase transition
GO:0060255	0.922	regulation of macromolecule metabolic process
GO:0009987	0.919	cellular process
GO:1902099	0.919	regulation of metaphase/anaphase transition of cell cycle
GO:0051171	0.917	regulation of nitrogen compound metabolic process
GO:0033047	0.917	regulation of mitotic sister chromatid segregation
GO:0080090	0.916	regulation of primary metabolic process
GO:0019219	0.904	regulation of nucleobase-containing compound metabolic process
GO:1905819	0.900	negative regulation of chromosome separation
GO:1902100	0.900	negative regulation of metaphase/anaphase transition of cell cycle
GO:0033046	0.900	negative regulation of sister chromatid segregation
GO:0007088	0.899	regulation of mitotic nuclear division
GO:0048518	0.894	positive regulation of biological process
GO:0048522	0.882	positive regulation of cellular process
GO:0050790	0.881	regulation of catalytic activity
GO:0051338	0.874	regulation of transferase activity
GO:0031399	0.866	regulation of protein modification process
GO:0009892	0.847	negative regulation of metabolic process
GO:0030071	0.847	regulation of mitotic metaphase/anaphase transition
GO:1901991	0.846	negative regulation of mitotic cell cycle phase transition
GO:0010605	0.843	negative regulation of macromolecule metabolic process
GO:0045839	0.832	negative regulation of mitotic nuclear division
GO:0051172	0.829	negative regulation of nitrogen compound metabolic process
GO:1903320	0.822	regulation of protein modification by small protein conjugation or removal
GO:0010965	0.811	regulation of mitotic sister chromatid separation
GO:2000816	0.801	negative regulation of mitotic sister chromatid separation
GO:0045841	0.790	negative regulation of mitotic metaphase/anaphase transition
GO:0031396	0.775	regulation of protein ubiquitination
GO:1903321	0.720	negative regulation of protein modification by small protein conjugation or removal
GO:0051348	0.713	negative regulation of transferase activity
GO:0007049	0.692	cell cycle
GO:0022402	0.635	cell cycle process
GO:0051052	0.613	regulation of DNA metabolic process
GO:0071704	0.596	organic substance metabolic process
GO:0051438	0.584	regulation of ubiquitin-protein transferase activity
GO:0006807	0.577	nitrogen compound metabolic process
GO:0044238	0.528	primary metabolic process
GO:0043170	0.515	macromolecule metabolic process
GO:0071840	0.512	cellular component organization or biogenesis
GO:0031397	0.484	negative regulation of protein ubiquitination
GO:0016043	0.460	cellular component organization
GO:0048583	0.433	regulation of response to stimulus
GO:0006996	0.417	organelle organization
GO:0090068	0.400	positive regulation of cell cycle process
GO:0031324	0.353	negative regulation of cellular metabolic process
GO:0045934	0.317	negative regulation of nucleobase-containing compound metabolic process
GO:0050896	0.315	response to stimulus
GO:0000278	0.314	mitotic cell cycle
GO:2001020	0.313	regulation of response to DNA damage stimulus
GO:0019538	0.307	protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005819	1.000	spindle
GO:0005829	0.999	cytosol
GO:0005654	0.999	nucleoplasm
GO:0032991	0.562	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.441	Transferases.

[back to server]