StarFunc result for job id Q9UKT5

User Input

>input (387 residues)
MAGSEPRSGTNSPPPPFSDWGRLEAAILSGWKTFWQSVSKERVARTTSREEVDEAASTLT
RLPIDVQLYILSFLSPHDLCQLGSTNHYWNETVRDPILWRYFLLRDLPSWSSVDWKSLPD
LEILKKPISEVTDGAFFDYMAVYRMCCPYTRRASKSSRPMYGAVTSFLHSLIIQNEPRFA
MFGPGLEELNTSLVLSLMSSEELCPTAGLPQRQIDGIGSGVNFQLNNQHKFNILILYSTT
RKERDRAREEHTSAVNKMFSRHNEGDDQQGSRYSVIPQIQKVCEVVDGFIYVANAEAHKR
HEWQDEFSHIMAMTDPAFGSSGRPLLVLSCISQGDVKRMPCFYLAHELHLNLLNHPWLVQ
DTEAETLTGFLNGIEWILEEVESKRAR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UKT5	1.000	1.000	1.084E-79	387	1.000	1.000	Q9UKT5.pdb.gz	FBX4_HUMAN F-box only protein 4 OS=Homo sapiens OX=9606 GN=FBXO4 PE=1 SV=2
2	AFDB:Q8CHQ0	0.960	0.965	1.334E-71	385	0.876	0.881	Q8CHQ0.pdb.gz	FBX4_MOUSE F-box only protein 4 OS=Mus musculus OX=10090 GN=Fbxo4 PE=1 SV=2
3	AFDB:A0A024R4C5	0.364	0.685	3.296E-6	192	0.098	0.198	A0A024R4C5.pdb.gz
4	AFDB:Q57UC6	0.290	0.204	4.435E-6	577	0.127	0.085	Q57UC6.pdb.gz	Q57UC6_TRYB2 FYVE-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.6C8.230 PE=4 SV=1
5	AFDB:Q585W3	0.325	0.641	6.718E-6	183	0.103	0.219	Q585W3.pdb.gz	Q585W3_TRYB2 ADP-ribosylation factor, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4F7.880 PE=3 SV=1
6	AFDB:E9ADU4	0.342	0.689	8.027E-6	179	0.096	0.207	E9ADU4.pdb.gz	E9ADU4_LEIMA Putative ADP ribosylation factor 3 OS=Leishmania major OX=5664 GN=LMJF_29_0880 PE=3 SV=1
7	AFDB:P49703	0.344	0.623	1.542E-5	201	0.085	0.164	P49703.pdb.gz	ARL4D_HUMAN ADP-ribosylation factor-like protein 4D OS=Homo sapiens OX=9606 GN=ARL4D PE=1 SV=2
8	AFDB:Q18510	0.325	0.605	1.954E-5	190	0.098	0.200	Q18510.pdb.gz	ARL6_CAEEL ADP-ribosylation factor-like protein 6 OS=Caenorhabditis elegans OX=6239 GN=arl-6 PE=2 SV=1
9	AFDB:P84084	0.309	0.610	2.335E-5	180	0.103	0.222	P84084.pdb.gz	ARF5_MOUSE ADP-ribosylation factor 5 OS=Mus musculus OX=10090 GN=Arf5 PE=1 SV=2
10	AFDB:A0A024R9Z2	0.361	0.650	2.478E-5	200	0.090	0.175	A0A024R9Z2.pdb.gz
11	PDB:3lrpA	0.312	0.603	7.130E-5	181	0.085	0.182	3lrpA.pdb.gz	Structure of Plasmodium falciparum ADP-ribosylation factor 1.
12	PDB:3doeA	0.337	0.652	7.566E-5	189	0.098	0.201	3doeA.pdb.gz	Crystal structure of the ARL2-GTP-BART complex reveals a novel recognition and binding mode of small GTPase with effector
13	PDB:1uptG	0.327	0.690	1.216E-4	170	0.090	0.206	1uptG.pdb.gz	Structural Basis for Arl1-Dependent Targeting of Homodimeric Grip Domains to the Golgi Apparatus
14	PDB:3o47A	0.310	0.399	1.290E-4	289	0.098	0.131	3o47A.pdb.gz	Crystal structure of ARFGAP1-ARF1 fusion protein
15	PDB:1z6xA	0.320	0.632	1.636E-4	175	0.096	0.211	1z6xA.pdb.gz	Structure Of Human ADP-Ribosylation Factor 4
16	PDB:5uf8A	0.271	0.566	2.074E-4	161	0.085	0.205	5uf8A.pdb.gz	Crystal structure of the ARF family small GTPase ARF2 from Candida albicans in complex with GDP
17	PDB:2b6hA	0.314	0.643	2.336E-4	171	0.096	0.216	2b6hA.pdb.gz	Structure of human ADP-ribosylation factor 5
18	PDB:4zi2A	0.320	0.620	2.791E-4	185	0.103	0.216	4zi2A.pdb.gz	The Interaction of CCDC104/BARTL1 with Arl3 and Implications for Ciliary Function.
19	PDB:6bbpA	0.310	0.237	3.754E-4	520	0.080	0.060	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
20	PDB:1zj6A	0.324	0.655	4.486E-4	173	0.093	0.208	1zj6A.pdb.gz	2.0A crystal structure of human ARL5-GDP3'P, a novel member of the small GTP-binding proteins

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8CHQ0	0.0	715	385	0.881	0.886	FBX4_MOUSE F-box only protein 4 OS=Mus musculus OX=10090 GN=Fbxo4 PE=1 SV=2
2	Q9UKT5	0.0	808	387	1.000	1.000	FBX4_HUMAN F-box only protein 4 OS=Homo sapiens OX=9606 GN=FBXO4 PE=1 SV=2
3	Q8C2S5	6.56e-06	50.4	690	0.080	0.045	FBXL5_MOUSE F-box/LRR-repeat protein 5 OS=Mus musculus OX=10090 GN=Fbxl5 PE=2 SV=2
4	Q9UKA1	2.33e-05	48.9	691	0.075	0.042	FBXL5_HUMAN F-box/LRR-repeat protein 5 OS=Homo sapiens OX=9606 GN=FBXL5 PE=1 SV=2
5	Q0VGT7	3.56e-04	44.7	347	0.049	0.055	Q0VGT7_MOUSE Fbxw7 protein OS=Mus musculus OX=10090 GN=Fbxw7 PE=2 SV=1
6	Q8VBV4	7.55e-04	43.9	710	0.049	0.027	FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus OX=10090 GN=Fbxw7 PE=1 SV=2
7	Q969H0	7.81e-04	43.9	707	0.049	0.027	FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens OX=9606 GN=FBXW7 PE=1 SV=1
8	Q86XK2	0.008	40.8	927	0.062	0.026	FBX11_HUMAN F-box only protein 11 OS=Homo sapiens OX=9606 GN=FBXO11 PE=1 SV=3
9	P87053	0.009	40.4	605	0.039	0.025	POF1_SCHPO F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pof1 PE=1 SV=1
10	Q7TPD1	0.009	40.8	930	0.062	0.026	FBX11_MOUSE F-box only protein 11 OS=Mus musculus OX=10090 GN=Fbxo11 PE=1 SV=3
11	Q7TSL3	0.009	40.8	843	0.062	0.028	FBX11_RAT F-box only protein 11 OS=Rattus norvegicus OX=10116 GN=Fbxo11 PE=2 SV=1
12	B7ZDC8	0.011	40.0	544	0.044	0.031	B7ZDC8_DANRE F-box and WD repeat domain-containing 7 OS=Danio rerio OX=7955 GN=fbxw7 PE=4 SV=1
13	Q9ZVQ6	0.014	39.3	272	0.049	0.070	P2B10_ARATH F-box protein PP2-B10 OS=Arabidopsis thaliana OX=3702 GN=PP2B10 PE=1 SV=1
14	Q1MTE5	0.031	37.7	182	0.083	0.176	ARL3_DANRE ADP-ribosylation factor-like protein 3 OS=Danio rerio OX=7955 GN=arl3 PE=2 SV=1
15	Q9VAK7	0.046	38.1	515	0.072	0.054	Q9VAK7_DROME F-box involved in polyQ pathogenesis, isoform A OS=Drosophila melanogaster OX=7227 GN=FipoQ PE=4 SV=2
16	Q3U7U3	0.097	37.4	523	0.054	0.040	FBX7_MOUSE F-box only protein 7 OS=Mus musculus OX=10090 GN=Fbxo7 PE=1 SV=2
17	Q8IX29	0.099	37.0	292	0.057	0.075	FBX16_HUMAN F-box only protein 16 OS=Homo sapiens OX=9606 GN=FBXO16 PE=1 SV=1
18	Q68FS3	0.14	36.6	522	0.054	0.040	FBX7_RAT F-box only protein 7 OS=Rattus norvegicus OX=10116 GN=Fbxo7 PE=2 SV=1
19	Q585W3	0.15	35.4	183	0.075	0.158	Q585W3_TRYB2 ADP-ribosylation factor, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4F7.880 PE=3 SV=1
20	Q9UJT9	0.22	36.2	491	0.106	0.084	FBXL7_HUMAN F-box/LRR-repeat protein 7 OS=Homo sapiens OX=9606 GN=FBXL7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00025 Arf	2e+02	12.8	ADP-ribosylation factor family
2	PF06881 Elongin_A	57	15.7	RNA polymerase II transcription factor SIII (Elongin) subunit A
3	PF00646 F-box	0.0083	27.2	F-box domain
4	PF12937 F-box-like	0.00079	30.6	F-box-like
5	PF09372 PRANC	82	15.0	PRANC domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000281623

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000276603	0.997	Telomeric repeat-binding factor 1
2	9606.ENSP00000231487	0.996	S-phase kinase-associated protein 1
3	9606.ENSP00000326804	0.977	Cullin-1
4	9606.ENSP00000227507	0.963	G1/S-specific cyclin-D1
5	9606.ENSP00000274255	0.910	S-phase kinase-associated protein 2
6	9606.ENSP00000281708	0.910	F-box/WD repeat-containing protein 7
7	9606.ENSP00000359206	0.898	F-box/WD repeat-containing protein 1A
8	9606.ENSP00000265094	0.862	F-box/WD repeat-containing protein 11
9	9606.ENSP00000310686	0.829	F-box/WD repeat-containing protein 8
10	9606.ENSP00000346240	0.822	F-box only protein 2
11	9606.ENSP00000244426	0.802	F-box only protein 9
12	9606.ENSP00000476369	0.772	F-box/WD repeat-containing protein 2
13	9606.ENSP00000216225	0.721	E3 ubiquitin-protein ligase RBX1
14	9606.ENSP00000250495	0.719	NEDD8
15	9606.ENSP00000433560	0.708	Alpha-crystallin B chain
16	9606.ENSP00000372136	0.699	Defensin, alpha 1B
17	9606.ENSP00000384823	0.679	F-box only protein 11
18	9606.ENSP00000313034	0.675	F-box/WD repeat-containing protein 5
19	9606.ENSP00000355827	0.654	F-box only protein 28
20	9606.ENSP00000444856	0.648	Cullin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	1.000	ubiquitin-protein transferase activity
GO:0042802	0.794	identical protein binding
GO:0046983	0.742	protein dimerization activity
GO:0042803	0.700	protein homodimerization activity
GO:0061659	0.515	ubiquitin-like protein ligase activity
GO:0061630	0.512	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0031399	0.987	regulation of protein modification process
GO:0071704	0.985	organic substance metabolic process
GO:1903320	0.982	regulation of protein modification by small protein conjugation or removal
GO:0030163	0.982	protein catabolic process
GO:0031647	0.981	regulation of protein stability
GO:0044248	0.980	cellular catabolic process
GO:0033043	0.979	regulation of organelle organization
GO:0006508	0.979	proteolysis
GO:0036211	0.976	protein modification process
GO:0051173	0.975	positive regulation of nitrogen compound metabolic process
GO:0010604	0.975	positive regulation of macromolecule metabolic process
GO:1903322	0.971	positive regulation of protein modification by small protein conjugation or removal
GO:0031396	0.967	regulation of protein ubiquitination
GO:0043161	0.965	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0031398	0.961	positive regulation of protein ubiquitination
GO:0051052	0.953	regulation of DNA metabolic process
GO:0033044	0.940	regulation of chromosome organization
GO:2000278	0.940	regulation of DNA biosynthetic process
GO:1904356	0.932	regulation of telomere maintenance via telomere lengthening
GO:0071840	0.926	cellular component organization or biogenesis
GO:0031146	0.924	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
GO:0048522	0.918	positive regulation of cellular process
GO:0032210	0.912	regulation of telomere maintenance via telomerase
GO:0010557	0.908	positive regulation of macromolecule biosynthetic process
GO:0016043	0.899	cellular component organization
GO:0051130	0.883	positive regulation of cellular component organization
GO:0070647	0.882	protein modification by small protein conjugation or removal
GO:0051054	0.881	positive regulation of DNA metabolic process
GO:2001252	0.859	positive regulation of chromosome organization
GO:0006996	0.800	organelle organization
GO:0032200	0.783	telomere organization
GO:0016567	0.767	protein ubiquitination
GO:0031328	0.722	positive regulation of cellular biosynthetic process
GO:0006725	0.662	cellular aromatic compound metabolic process
GO:0050896	0.543	response to stimulus
GO:2000573	0.509	positive regulation of DNA biosynthetic process
GO:0032206	0.509	positive regulation of telomere maintenance
GO:0046483	0.463	heterocycle metabolic process
GO:0048519	0.453	negative regulation of biological process
GO:0000209	0.409	protein polyubiquitination
GO:0048523	0.408	negative regulation of cellular process
GO:0006259	0.398	DNA metabolic process
GO:0051716	0.382	cellular response to stimulus
GO:0000723	0.366	telomere maintenance
GO:0060341	0.343	regulation of cellular localization
GO:0032880	0.322	regulation of protein localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019005	0.998	SCF ubiquitin ligase complex
GO:0005829	0.979	cytosol
GO:0043226	0.815	organelle
GO:0070013	0.565	intracellular organelle lumen
GO:0031981	0.560	nuclear lumen
GO:0005654	0.474	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]