StarFunc result for job id Q9UKT7

User Input

>input (428 residues)
MKRGGRDSDRNSSEEGTAEKSKKLRTTNEHSQTCDWGNLLQDIILQVFKYLPLLDRAHAS
QVCRNWNQVFHMPDLWRCFEFELNQPATSYLKATHPELIKQIIKRHSNHLQYVSFKVDSS
KESAEAACDILSQLVNCSLKTLGLISTARPSFMDLPKSHFISALTVVFVNSKSLSSLKID
DTPVDDPSLKVLVANNSDTLKLLKMSSCPHVSPAGILCVADQCHGLRELALNYHLLSDEL
LLALSSEKHVRLEHLRIDVVSENPGQTHFHTIQKSSWDAFIRHSPKVNLVMYFFLYEEEF
DPFFRYEIPATHLYFGRSVSKDVLGRVGMTCPRLVELVVCANGLRPLDEELIRIAERCKN
LSAIGLGECEVSCSAFVEFVKMCGGRLSQLSIMEEVLIPDQKYSLEQIHWEVSKHLGRVW
FPDMMPTW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8C4V4	0.920	0.920	1.204E-76	428	0.972	0.972	Q8C4V4.pdb.gz	FBXL3_MOUSE F-box/LRR-repeat protein 3 OS=Mus musculus OX=10090 GN=Fbxl3 PE=1 SV=1
2	AFDB:Q8BFZ4	0.910	0.897	5.776E-68	434	0.734	0.724	Q8BFZ4.pdb.gz	FXL21_MOUSE F-box/LRR-repeat protein 21 OS=Mus musculus OX=10090 GN=Fbxl21 PE=1 SV=1
3	AFDB:Q9UKT6	0.927	0.914	2.223E-67	434	0.717	0.707	Q9UKT6.pdb.gz	FXL21_HUMAN Putative F-box/LRR-repeat protein 21 OS=Homo sapiens OX=9606 GN=FBXL21P PE=5 SV=1
4	PDB:4i6jB	0.899	0.976	2.801E-66	394	0.921	1.000	4i6jB.pdb.gz
5	AFDB:C9J0Y7	0.398	0.703	4.540E-35	241	0.561	0.996	C9J0Y7.pdb.gz	C9J0Y7_HUMAN F-box and leucine rich repeat protein 3 (Fragment) OS=Homo sapiens OX=9606 GN=FBXL3 PE=1 SV=1
6	AFDB:Q7Z6M2	0.709	0.562	1.640E-20	555	0.187	0.144	Q7Z6M2.pdb.gz	FBX33_HUMAN F-box only protein 33 OS=Homo sapiens OX=9606 GN=FBXO33 PE=1 SV=1
7	AFDB:Q96CD0	0.623	0.701	2.715E-17	374	0.166	0.190	Q96CD0.pdb.gz	FBXL8_HUMAN F-box/LRR-repeat protein 8 OS=Homo sapiens OX=9606 GN=FBXL8 PE=1 SV=1
8	AFDB:Q9UF56	0.479	0.318	4.494E-14	701	0.154	0.094	Q9UF56.pdb.gz	FXL17_HUMAN F-box/LRR-repeat protein 17 OS=Homo sapiens OX=9606 GN=FBXL17 PE=1 SV=3
9	AFDB:Q8N4B4	0.652	0.634	1.381E-13	442	0.194	0.188	Q8N4B4.pdb.gz	FBX39_HUMAN F-box only protein 39 OS=Homo sapiens OX=9606 GN=FBXO39 PE=1 SV=1
10	AFDB:Q8N531	0.515	0.429	2.165E-13	539	0.157	0.124	Q8N531.pdb.gz	FBXL6_HUMAN F-box/LRR-repeat protein 6 OS=Homo sapiens OX=9606 GN=FBXL6 PE=2 SV=2
11	AFDB:Q9VF10	0.522	0.320	2.165E-13	772	0.194	0.108	Q9VF10.pdb.gz	Q9VF10_DROME F-box and leucine-rich repeat protein 7 OS=Drosophila melanogaster OX=7227 GN=Fbxl7 PE=1 SV=2
12	PDB:3oglB	0.300	0.242	6.698E-12	568	0.178	0.134	3oglB.pdb.gz	Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor.
13	PDB:6o60C	0.505	0.547	1.555E-11	389	0.154	0.170	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.
14	PDB:7sa1B	0.425	0.319	1.389E-10	624	0.138	0.095	7sa1B.pdb.gz
15	PDB:2p1nB	0.352	0.285	1.241E-9	571	0.178	0.133	2p1nB.pdb.gz	Mechanism of auxin perception by the TIR1 ubiquitin ligase
16	PDB:5hywA	0.373	0.297	1.048E-7	580	0.138	0.102	5hywA.pdb.gz
17	PDB:1a4yA	0.509	0.480	1.240E-7	460	0.140	0.130	1a4yA.pdb.gz
18	PDB:7b5mT	0.413	0.512	3.044E-7	325	0.157	0.206	7b5mT.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
19	PDB:7pmkL	0.435	0.402	5.337E-7	475	0.140	0.126	7pmkL.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
20	PDB:1k5dC	0.467	0.555	5.043E-6	344	0.093	0.116	1k5dC.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BFZ4	0.0	640	434	0.727	0.717	FXL21_MOUSE F-box/LRR-repeat protein 21 OS=Mus musculus OX=10090 GN=Fbxl21 PE=1 SV=1
2	Q8C4V4	0.0	864	428	0.972	0.972	FBXL3_MOUSE F-box/LRR-repeat protein 3 OS=Mus musculus OX=10090 GN=Fbxl3 PE=1 SV=1
3	Q9UKT6	0.0	611	434	0.717	0.707	FXL21_HUMAN Putative F-box/LRR-repeat protein 21 OS=Homo sapiens OX=9606 GN=FBXL21P PE=5 SV=1
4	Q9UKT7	0.0	887	428	1.000	1.000	FBXL3_HUMAN F-box/LRR-repeat protein 3 OS=Homo sapiens OX=9606 GN=FBXL3 PE=1 SV=1
5	C9J0Y7	3.03e-166	468	241	0.563	1.000	C9J0Y7_HUMAN F-box and leucine rich repeat protein 3 (Fragment) OS=Homo sapiens OX=9606 GN=FBXL3 PE=1 SV=1
6	Q8N1E6	1.97e-06	52.0	418	0.124	0.127	FXL14_HUMAN F-box/LRR-repeat protein 14 OS=Homo sapiens OX=9606 GN=FBXL14 PE=1 SV=1
7	Q5RH13	5.57e-05	47.4	400	0.138	0.147	Q5RH13_DANRE F-box and leucine-rich repeat protein 14b OS=Danio rerio OX=7955 GN=fbxl14 PE=2 SV=1
8	Q9Z0Z3	1.96e-04	45.8	424	0.185	0.186	SKP2_MOUSE S-phase kinase-associated protein 2 OS=Mus musculus OX=10090 GN=Skp2 PE=1 SV=1
9	Q9FLX3	3.44e-04	44.7	269	0.054	0.086	FB293_ARATH F-box protein At5g52880 OS=Arabidopsis thaliana OX=3702 GN=At5g52880 PE=2 SV=1
10	Q9ZPE4	0.002	42.0	317	0.100	0.136	FBW2_ARATH F-box protein FBW2 OS=Arabidopsis thaliana OX=3702 GN=FBW2 PE=1 SV=1
11	Q6TGX5	0.003	42.0	411	0.100	0.105	Q6TGX5_DANRE F-box and leucine-rich repeat protein 14a OS=Danio rerio OX=7955 GN=wu:fi25d04 PE=2 SV=1
12	Q13309	0.012	40.0	424	0.178	0.179	SKP2_HUMAN S-phase kinase-associated protein 2 OS=Homo sapiens OX=9606 GN=SKP2 PE=1 SV=2
13	Q8N4B4	0.013	40.0	442	0.044	0.043	FBX39_HUMAN F-box only protein 39 OS=Homo sapiens OX=9606 GN=FBXO39 PE=1 SV=1
14	A0A0A0MTL5	0.015	40.0	458	0.178	0.166	A0A0A0MTL5_HUMAN S-phase kinase associated protein 2 OS=Homo sapiens OX=9606 GN=SKP2 PE=1 SV=2
15	Q7Z6M2	0.022	39.7	555	0.143	0.110	FBX33_HUMAN F-box only protein 33 OS=Homo sapiens OX=9606 GN=FBXO33 PE=1 SV=1
16	A0A0B4KEK4	0.028	38.9	455	0.117	0.110	A0A0B4KEK4_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9003 PE=4 SV=1
17	A8DYA5	0.028	38.9	426	0.117	0.117	A8DYA5_DROME LP16447p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9003 PE=2 SV=1
18	A0A0B4KEU4	0.029	38.9	497	0.117	0.101	A0A0B4KEU4_DROME Uncharacterized protein, isoform F OS=Drosophila melanogaster OX=7227 GN=FBXL2 PE=4 SV=1
19	Q5BI22	0.029	38.9	437	0.117	0.114	Q5BI22_DROME LD12638p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9003 PE=2 SV=1
20	A0A8I6AMP0	0.031	38.9	439	0.105	0.103	A0A8I6AMP0_RAT S-phase kinase associated protein 2 OS=Rattus norvegicus OX=10116 GN=Skp2 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13475 DUF4116	24	16.1	Domain of unknown function (DUF4116)
2	PF00646 F-box	0.00094	30.2	F-box domain
3	PF12937 F-box-like	7.7e-05	33.8	F-box-like
4	PF18511 F-box_5	2e+02	13.0	F-box

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347834

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000008527	0.999	Cryptochrome-1
2	9606.ENSP00000231487	0.999	S-phase kinase-associated protein 1
3	9606.ENSP00000478187	0.999	Cryptochrome-2
4	9606.ENSP00000326804	0.988	Cullin-1
5	9606.ENSP00000384517	0.923	Aryl hydrocarbon receptor nuclear translocator-like protein 1
6	9606.ENSP00000254657	0.905	Period circadian protein homolog 2
7	9606.ENSP00000380044	0.887	Casein kinase I isoform epsilon
8	9606.ENSP00000308741	0.886	Circadian locomoter output cycles protein kaput
9	9606.ENSP00000324464	0.882	Casein kinase I isoform delta
10	9606.ENSP00000338283	0.873	Neuronal PAS domain-containing protein 2
11	9606.ENSP00000314420	0.864	Period circadian protein homolog 1
12	9606.ENSP00000321927	0.767	F-box/LRR-repeat protein 13
13	9606.ENSP00000216225	0.742	E3 ubiquitin-protein ligase RBX1
14	9606.ENSP00000246672	0.741	Nuclear receptor subfamily 1 group D member 1
15	9606.ENSP00000369604	0.740	F-box only protein 16
16	9606.ENSP00000250495	0.736	NEDD8
17	9606.ENSP00000371805	0.722	F-box/LRR-repeat protein 18
18	9606.ENSP00000280326	0.692	T-complex protein 1 subunit epsilon
19	9606.ENSP00000359206	0.678	F-box/WD repeat-containing protein 1A
20	9606.ENSP00000482093	0.671	Period circadian protein homolog 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	1.000	ubiquitin-protein transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0050789	0.996	regulation of biological process
GO:0044238	0.996	primary metabolic process
GO:0006807	0.994	nitrogen compound metabolic process
GO:0043170	0.993	macromolecule metabolic process
GO:0009987	0.992	cellular process
GO:0042752	0.991	regulation of circadian rhythm
GO:0044237	0.974	cellular metabolic process
GO:0070647	0.967	protein modification by small protein conjugation or removal
GO:0032446	0.962	protein modification by small protein conjugation
GO:0010498	0.956	proteasomal protein catabolic process
GO:0050896	0.955	response to stimulus
GO:0019941	0.946	modification-dependent protein catabolic process
GO:0016567	0.945	protein ubiquitination
GO:0031146	0.935	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
GO:0009314	0.753	response to radiation
GO:0009416	0.713	response to light stimulus
GO:0009649	0.677	entrainment of circadian clock
GO:0009648	0.619	photoperiodism
GO:0050794	0.450	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.999	nucleoplasm
GO:0032991	0.972	protein-containing complex
GO:0140535	0.830	intracellular protein-containing complex
GO:1902494	0.789	catalytic complex
GO:1990234	0.688	transferase complex
GO:0000151	0.661	ubiquitin ligase complex
GO:0031461	0.646	cullin-RING ubiquitin ligase complex
GO:0019005	0.587	SCF ubiquitin ligase complex
GO:0016604	0.481	nuclear body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]