StarFunc result for job id Q9UKT9

User Input

>input (509 residues)
MEDIQTNAELKSTQEQSVPAESAAVLNDYSLTKSHEMENVDSGEGPANEDEDIGDDSMKV
KDEYSERDENVLKSEPMGNAEEPEIPYSYSREYNEYENIKLERHVVSFDSSRPTSGKMNC
DVCGLSCISFNVLMVHKRSHTGERPFQCNQCGASFTQKGNLLRHIKLHTGEKPFKCHLCN
YACQRRDALTGHLRTHSVEKPYKCEFCGRSYKQRSSLEEHKERCRTFLQSTDPGDTASAE
ARHIKAEMGSERALVLDRLASNVAKRKSSMPQKFIGEKRHCFDVNYNSSYMYEKESELIQ
TRMMDQAINNAISYLGAEALRPLVQTPPAPTSEMVPVISSMYPIALTRAEMSNGAPQELE
KKSIHLPEKSVPSERGLSPNNSGHDSTDTDSNHEERQNHIYQQNHMVLSRARNGMPLLKE
VPRSYELLKPPPICPRDSVKVINKEGEVMDVYRCDHCRVLFLDYVMFTIHMGCHGFRDPF
ECNMCGYRSHDRYEFSSHIARGEHRALLK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UKT9	1.000	1.000	1.829E-88	509	1.000	1.000	Q9UKT9.pdb.gz	IKZF3_HUMAN Zinc finger protein Aiolos OS=Homo sapiens OX=9606 GN=IKZF3 PE=1 SV=2
2	AFDB:O08900	0.376	0.378	1.618E-69	507	0.866	0.870	O08900.pdb.gz	IKZF3_MOUSE Zinc finger protein Aiolos OS=Mus musculus OX=10090 GN=Ikzf3 PE=1 SV=2
3	AFDB:O42410	0.221	0.217	2.117E-40	518	0.530	0.521	O42410.pdb.gz	IKZF1_CHICK DNA-binding protein Ikaros OS=Gallus gallus OX=9031 GN=IKZF1 PE=2 SV=1
4	AFDB:B8A603	0.188	0.181	2.896E-32	537	0.483	0.458	B8A603.pdb.gz
5	AFDB:Q90W82	0.172	0.158	8.199E-30	563	0.456	0.412	Q90W82.pdb.gz	Q90W82_CHICK IKAROS family zinc finger 2 OS=Gallus gallus OX=9031 GN=HELIOS PE=2 SV=1
6	AFDB:Q96NL3	0.199	0.175	4.867E-13	588	0.165	0.143	Q96NL3.pdb.gz	ZN599_HUMAN Zinc finger protein 599 OS=Homo sapiens OX=9606 GN=ZNF599 PE=1 SV=1
7	AFDB:Q8TF47	0.216	0.176	3.128E-12	636	0.193	0.154	Q8TF47.pdb.gz	ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens OX=9606 GN=ZFP90 PE=1 SV=2
8	AFDB:Q8K2R5	0.207	0.172	3.336E-12	619	0.181	0.149	Q8K2R5.pdb.gz	ZN668_MOUSE Zinc finger protein 668 OS=Mus musculus OX=10090 GN=Znf668 PE=2 SV=1
9	AFDB:Q923T4	0.193	0.203	5.227E-12	484	0.171	0.180	Q923T4.pdb.gz	Q923T4_MOUSE Zinc finger protein ZFEND OS=Mus musculus OX=10090 GN=Zfp358 PE=2 SV=1
10	AFDB:Q6DD87	0.209	0.272	5.573E-12	382	0.169	0.225	Q6DD87.pdb.gz	ZN787_HUMAN Zinc finger protein 787 OS=Homo sapiens OX=9606 GN=ZNF787 PE=1 SV=4
11	PDB:4n78F	0.094	0.242	2.429	156	0.039	0.128	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
12	PDB:7pmkQ	0.056	0.040	2.429	766	0.037	0.025	7pmkQ.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
13	PDB:5gmkt	0.068	0.207	3.139	156	0.039	0.128	5gmkt.pdb.gz	Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
14	PDB:4wlwA	0.083	0.253	3.347	130	0.029	0.115	4wlwA.pdb.gz	TRANSCRIPTION. Allosteric transcriptional regulation via changes in the overall topology of the core promoter.
15	PDB:5c8dE	0.056	0.090	3.805	280	0.024	0.043	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
16	PDB:6nmiC	0.064	0.078	4.057	408	0.053	0.066	6nmiC.pdb.gz	The complete structure of the human TFIIH core complex.
17	PDB:6t9lN	0.048	0.255	4.057	82	0.014	0.085	6t9lN.pdb.gz	Structure of the transcription coactivator SAGA.
18	PDB:7v3vI	0.053	0.076	4.919	328	0.029	0.046	7v3vI.pdb.gz	Structural Insight into the MCM double hexamer activation by Dbf4-Cdc7 kinase.
19	PDB:7z36B	0.066	0.074	4.919	446	0.055	0.063	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
20	PDB:6wucH	0.076	0.188	5.963	179	0.039	0.112	6wucH.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O08900	0.0	927	507	0.866	0.870	IKZF3_MOUSE Zinc finger protein Aiolos OS=Mus musculus OX=10090 GN=Ikzf3 PE=1 SV=2
2	Q9UKT9	0.0	1062	509	1.000	1.000	IKZF3_HUMAN Zinc finger protein Aiolos OS=Homo sapiens OX=9606 GN=IKZF3 PE=1 SV=2
3	Q13422	1.77e-178	513	519	0.521	0.511	IKZF1_HUMAN DNA-binding protein Ikaros OS=Homo sapiens OX=9606 GN=IKZF1 PE=1 SV=1
4	O42410	7.64e-177	509	518	0.515	0.506	IKZF1_CHICK DNA-binding protein Ikaros OS=Gallus gallus OX=9031 GN=IKZF1 PE=2 SV=1
5	Q03267	1.50e-166	483	517	0.511	0.503	IKZF1_MOUSE DNA-binding protein Ikaros OS=Mus musculus OX=10090 GN=Ikzf1 PE=1 SV=2
6	Q5SWU0	3.36e-155	451	428	0.475	0.565	Q5SWU0_MOUSE IKAROS family zinc finger 1 OS=Mus musculus OX=10090 GN=Ikzf1 PE=1 SV=1
7	P81183	5.38e-154	451	526	0.483	0.468	IKZF2_MOUSE Zinc finger protein Helios OS=Mus musculus OX=10090 GN=Ikzf2 PE=1 SV=2
8	Q9UKS7	2.28e-153	449	526	0.452	0.437	IKZF2_HUMAN Zinc finger protein Helios OS=Homo sapiens OX=9606 GN=IKZF2 PE=1 SV=2
9	O93581	2.93e-152	447	537	0.468	0.443	O93581_DANRE DNA-binding protein Ikaros OS=Danio rerio OX=7955 GN=znfn1a1 PE=2 SV=1
10	Q90W82	5.56e-141	419	563	0.448	0.405	Q90W82_CHICK IKAROS family zinc finger 2 OS=Gallus gallus OX=9031 GN=HELIOS PE=2 SV=1
11	F8VPL6	7.62e-137	408	540	0.430	0.406	F8VPL6_HUMAN IKAROS family zinc finger 4 OS=Homo sapiens OX=9606 GN=IKZF4 PE=1 SV=1
12	Q9H2S9	3.17e-136	408	585	0.430	0.374	IKZF4_HUMAN Zinc finger protein Eos OS=Homo sapiens OX=9606 GN=IKZF4 PE=1 SV=2
13	Q8C208	4.99e-135	405	586	0.430	0.374	IKZF4_MOUSE Zinc finger protein Eos OS=Mus musculus OX=10090 GN=Ikzf4 PE=1 SV=2
14	A0A087WU46	6.99e-117	349	336	0.377	0.571	A0A087WU46_HUMAN IKAROS family zinc finger 1 OS=Homo sapiens OX=9606 GN=IKZF1 PE=1 SV=1
15	A0A0A0MRA0	1.06e-80	253	249	0.265	0.542	A0A0A0MRA0_HUMAN IKAROS family zinc finger 1 OS=Homo sapiens OX=9606 GN=IKZF1 PE=1 SV=1
16	R9R4D9	2.02e-51	178	268	0.173	0.328	R9R4D9_HUMAN IKAROS family zinc finger 1 isoform 14 OS=Homo sapiens OX=9606 GN=IKZF1 PE=1 SV=1
17	Q6DBW0	1.14e-33	134	419	0.210	0.255	IKZF5_DANRE Zinc finger protein Pegasus OS=Danio rerio OX=7955 GN=ikzf5 PE=2 SV=1
18	Q9H5V7	4.52e-32	129	419	0.191	0.232	IKZF5_HUMAN Zinc finger protein Pegasus OS=Homo sapiens OX=9606 GN=IKZF5 PE=1 SV=1
19	Q8NDW4	1.88e-26	115	579	0.102	0.090	ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens OX=9606 GN=ZNF248 PE=1 SV=1
20	Q15776	1.20e-25	112	578	0.096	0.085	ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens OX=9606 GN=ZKSCAN8 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11672 DUF3268	3.6e+02	12.9	zinc-finger-containing domain
2	PF09237 GAGA	6.1e+02	11.8	GAGA factor
3	PF00096 zf-C2H2	7e-12	56.2	Zinc finger, C2H2 type
4	PF16622 zf-C2H2_11	23	16.2	zinc-finger C2H2-type
5	PF13894 zf-C2H2_4	1.9e-07	42.3	C2H2-type zinc finger
6	PF13913 zf-C2HC_2	77	14.6	zinc-finger of a C2HC-type
7	PF13465 zf-H2C2_2	1.7e-20	83.6	Zinc-finger double domain
8	PF13909 zf-H2C2_5	1.9	19.6	C2H2-type zinc-finger domain
9	PF02591 zf-RING_7	2.1e+02	13.5	C4-type zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000344544

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231948	0.990	Protein cereblon
2	9606.ENSP00000216223	0.943	Interleukin-2 receptor subunit beta
3	9606.ENSP00000226730	0.942	Interleukin-2
4	9606.ENSP00000407586	0.936	GTPase HRas
5	9606.ENSP00000369293	0.934	Interleukin-2 receptor subunit alpha
6	9606.ENSP00000376345	0.929	Growth factor receptor-bound protein 2
7	9606.ENSP00000337825	0.926	Tyrosine-protein kinase Lck
8	9606.ENSP00000391676	0.924	Tyrosine-protein kinase JAK3
9	9606.ENSP00000343204	0.917	Tyrosine-protein kinase JAK1
10	9606.ENSP00000358548	0.916	GTPase NRas
11	9606.ENSP00000363318	0.913	Cytokine receptor common subunit gamma
12	9606.ENSP00000215832	0.912	Mitogen-activated protein kinase 1
13	9606.ENSP00000263025	0.912	Mitogen-activated protein kinase 3
14	9606.ENSP00000401303	0.910	SHC-transforming protein 1
15	9606.ENSP00000256078	0.909	GTPase KRas
16	9606.ENSP00000276420	0.904	Docking protein 2
17	9606.ENSP00000387784	0.904	Son of sevenless homolog 1
18	9606.ENSP00000330341	0.902	Suppressor of cytokine signaling 3
19	9606.ENSP00000354952	0.901	GRB2-associated-binding protein 2
20	9606.ENSP00000381185	0.901	Apoptosis regulator Bcl-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043565	1.000	sequence-specific DNA binding
GO:0000981	0.997	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001228	0.983	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0042802	0.890	identical protein binding
GO:0019899	0.855	enzyme binding
GO:0000976	0.815	transcription cis-regulatory region binding
GO:0003682	0.638	chromatin binding
GO:0046983	0.638	protein dimerization activity
GO:0042803	0.621	protein homodimerization activity
GO:0042826	0.549	histone deacetylase binding
GO:0046982	0.507	protein heterodimerization activity
GO:1990841	0.498	promoter-specific chromatin binding
GO:0000977	0.486	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0019222	0.985	regulation of metabolic process
GO:0060255	0.979	regulation of macromolecule metabolic process
GO:0080090	0.970	regulation of primary metabolic process
GO:0031323	0.970	regulation of cellular metabolic process
GO:0051171	0.949	regulation of nitrogen compound metabolic process
GO:0009987	0.946	cellular process
GO:0010468	0.906	regulation of gene expression
GO:0010556	0.906	regulation of macromolecule biosynthetic process
GO:0031326	0.906	regulation of cellular biosynthetic process
GO:0006355	0.904	regulation of DNA-templated transcription
GO:0048518	0.816	positive regulation of biological process
GO:0032502	0.677	developmental process
GO:0048522	0.672	positive regulation of cellular process
GO:0048856	0.581	anatomical structure development
GO:0050896	0.535	response to stimulus
GO:0006357	0.521	regulation of transcription by RNA polymerase II
GO:0009893	0.447	positive regulation of metabolic process
GO:0010604	0.430	positive regulation of macromolecule metabolic process
GO:0051173	0.419	positive regulation of nitrogen compound metabolic process
GO:0031325	0.414	positive regulation of cellular metabolic process
GO:0048523	0.307	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0005654	0.998	nucleoplasm
GO:0005829	0.978	cytosol
GO:0043228	0.635	non-membrane-bounded organelle
GO:0043232	0.615	intracellular non-membrane-bounded organelle
GO:0032991	0.352	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]