StarFunc result for job id Q9UKU6

User Input

>input (1024 residues)
MGEDDAALRAGSRGLSDPWADSVGVRPRTTERHIAVHKRLVLAFAVSLVALLAVTMLAVL
LSLRFDECGASATPGADGGPSGFPERGGNGSLPGSARRNHHAGGDSWQPEAGGVASPGTT
SAQPPSEEEREPWEPWTQLRLSGHLKPLHYNLMLTAFMENFTFSGEVNVEIACRNATRYV
VLHASRVAVEKVQLAEDRAFGAVPVAGFFLYPQTQVLVVVLNRTLDAQRNYNLKIIYNAL
IENELLGFFRSSYVLHGERRFLGVTQFSPTHARKAFPCFDEPIYKATFKISIKHQATYLS
LSNMPVETSVFEEDGWVTDHFSQTPLMSTYYLAWAICNFTYRETTTKSGVVVRLYARPDA
IRRGSGDYALHITKRLIEFYEDYFKVPYSLPKLDLLAVPKHPYAAMENWGLSIFVEQRIL
LDPSVSSISYLLDVTMVIVHEICHQWFGDLVTPVWWEDVWLKEGFAHYFEFVGTDYLYPG
WNMEKQRFLTDVLHEVMLLDGLASSHPVSQEVLQATDIDRVFDWIAYKKGAALIRMLANF
MGHSVFQRGLQDYLTIHKYGNAARNDLWNTLSEALKRNGKYVNIQEVMDQWTLQMGYPVI
TILGNTTAENRIIITQQHFIYDISAKTKALKLQNNSYLWQIPLTIVVGNRSHVSSEAIIW
VSNKSEHHRITYLDKGSWLLGNINQTGYFRVNYDLRNWRLLIDQLIRNHEVLSVSNRAGL
IDDAFSLARAGYLPQNIPLEIIRYLSEEKDFLPWHAASRALYPLDKLLDRMENYNIFNEY
ILKQVATTYIKLGWPKNNFNGSLVQASYQHEELRREVIMLACSFGNKHCHQQASTLISDW
ISSNRNRIPLNVRDIVYCTGVSLLDEDVWEFIWMKFHSTTAVSEKKILLEALTCSDDRNL
LNRLLNLSLNSEVVLDQDAIDVIIHVARNPHGRDLAWKFFRDKWKILNTRYGEALFMNSK
LISGVTEFLNTEGELKELKNFMKNYDGVAAASFSRAVETVEANVRWKMLYQDELFQWLGK
ALRH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q10836	0.979	0.978	0.000	1025	0.957	0.956	Q10836.pdb.gz	TRHDE_RAT Thyrotropin-releasing hormone-degrading ectoenzyme OS=Rattus norvegicus OX=10116 GN=Trhde PE=1 SV=1
2	AFDB:P15541	0.827	0.875	1.115E-77	966	0.317	0.336	P15541.pdb.gz	AMPN_RABIT Aminopeptidase N OS=Oryctolagus cuniculus OX=9986 GN=ANPEP PE=1 SV=4
3	AFDB:P15684	0.824	0.874	4.606E-77	965	0.322	0.342	P15684.pdb.gz	AMPN_RAT Aminopeptidase N OS=Rattus norvegicus OX=10116 GN=Anpep PE=1 SV=2
4	AFDB:P97449	0.832	0.881	1.610E-76	966	0.315	0.334	P97449.pdb.gz	AMPN_MOUSE Aminopeptidase N OS=Mus musculus OX=10090 GN=Anpep PE=1 SV=4
5	AFDB:Q59E93	0.830	0.869	5.178E-76	977	0.318	0.334	Q59E93.pdb.gz	Q59E93_HUMAN Aminopeptidase (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
6	AFDB:Q9VFX0	0.812	0.837	3.529E-75	994	0.302	0.311	Q9VFX0.pdb.gz	Q9VFX0_DROME Aminopeptidase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8773 PE=1 SV=2
7	AFDB:Q9EQH2	0.819	0.900	1.088E-74	930	0.299	0.329	Q9EQH2.pdb.gz	ERAP1_MOUSE Endoplasmic reticulum aminopeptidase 1 OS=Mus musculus OX=10090 GN=Erap1 PE=1 SV=2
8	AFDB:Q6P179	0.808	0.861	1.080E-73	960	0.294	0.314	Q6P179.pdb.gz	ERAP2_HUMAN Endoplasmic reticulum aminopeptidase 2 OS=Homo sapiens OX=9606 GN=ERAP2 PE=1 SV=2
9	AFDB:Q9NZ08	0.817	0.888	1.446E-73	941	0.282	0.307	Q9NZ08.pdb.gz	ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1 OS=Homo sapiens OX=9606 GN=ERAP1 PE=1 SV=3
10	PDB:5lhdC	0.814	0.918	5.891E-73	905	0.306	0.346	5lhdC.pdb.gz	Allosteric inhibition of aminopeptidase N functions related to tumor growth and virus infection.
11	AFDB:Q7KRW4	0.817	0.838	1.214E-72	999	0.290	0.297	Q7KRW4.pdb.gz	Q7KRW4_DROME Aminopeptidase OS=Drosophila melanogaster OX=7227 GN=superdeath PE=1 SV=1
12	PDB:6rqxA	0.806	0.955	5.560E-71	862	0.277	0.329	6rqxA.pdb.gz	Mechanism for antigenic peptide selection by endoplasmic reticulum aminopeptidase 1.
13	PDB:7nupD	0.811	0.936	1.218E-69	884	0.290	0.336	7nupD.pdb.gz	Endoplasmic reticulum aminopeptidase 2 complexed with a mixed hydroxamic and sulfonyl ligand
14	PDB:7pfsA	0.813	0.907	1.849E-69	916	0.292	0.326	7pfsA.pdb.gz	Inhibitor-Dependent Usage of the S1' Specificity Pocket of ER Aminopeptidase 2.
15	PDB:4kx7A	0.813	0.949	3.429E-68	875	0.280	0.328	4kx7A.pdb.gz	Structural insights into central hypertension regulation by human aminopeptidase a.
16	PDB:5k1vB	0.770	0.924	9.110E-65	849	0.285	0.344	5k1vB.pdb.gz	Crystal Structures of ERAP2 Complexed with Inhibitors Reveal Pharmacophore Requirements for Optimizing Inhibitor Potency.
17	PDB:3mdjC	0.661	0.809	4.794E-63	819	0.268	0.335	3mdjC.pdb.gz	Structural basis for antigenic peptide precursor processing by the endoplasmic reticulum aminopeptidase ERAP1.
18	PDB:4wz9B	0.749	0.860	5.574E-61	887	0.245	0.283	4wz9B.pdb.gz	The Anopheles-midgut APN1 structure reveals a new malaria transmission-blocking vaccine epitope.
19	PDB:4xo4A	0.657	0.763	2.519E-35	870	0.157	0.185	4xo4A.pdb.gz	Crystal Structure of E. coli Aminopeptidase N in complex with L-Methionine
20	PDB:3b7rL	0.375	0.604	4.845E-23	610	0.117	0.197	3b7rL.pdb.gz	Structure-based dissection of the active site chemistry of leukotriene a4 hydrolase: implications for m1 aminopeptidases and inhibitor design.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P15144	0.0	561	967	0.323	0.342	AMPN_HUMAN Aminopeptidase N OS=Homo sapiens OX=9606 GN=ANPEP PE=1 SV=4
2	P15541	0.0	555	966	0.318	0.337	AMPN_RABIT Aminopeptidase N OS=Oryctolagus cuniculus OX=9986 GN=ANPEP PE=1 SV=4
3	P15684	0.0	570	965	0.327	0.347	AMPN_RAT Aminopeptidase N OS=Rattus norvegicus OX=10116 GN=Anpep PE=1 SV=2
4	P97449	0.0	558	966	0.320	0.340	AMPN_MOUSE Aminopeptidase N OS=Mus musculus OX=10090 GN=Anpep PE=1 SV=4
5	Q10836	0.0	2010	1025	0.958	0.957	TRHDE_RAT Thyrotropin-releasing hormone-degrading ectoenzyme OS=Rattus norvegicus OX=10116 GN=Trhde PE=1 SV=1
6	Q59E93	0.0	561	977	0.323	0.339	Q59E93_HUMAN Aminopeptidase (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
7	Q9UKU6	0.0	2127	1024	1.000	1.000	TRHDE_HUMAN Thyrotropin-releasing hormone-degrading ectoenzyme OS=Homo sapiens OX=9606 GN=TRHDE PE=2 SV=1
8	P50123	6.29e-167	516	945	0.302	0.327	AMPE_RAT Glutamyl aminopeptidase OS=Rattus norvegicus OX=10116 GN=Enpep PE=1 SV=2
9	Q7KRW4	9.47e-167	518	999	0.292	0.299	Q7KRW4_DROME Aminopeptidase OS=Drosophila melanogaster OX=7227 GN=superdeath PE=1 SV=1
10	P16406	1.44e-165	513	945	0.304	0.329	AMPE_MOUSE Glutamyl aminopeptidase OS=Mus musculus OX=10090 GN=Enpep PE=1 SV=1
11	Q9VFX0	3.26e-164	511	994	0.305	0.314	Q9VFX0_DROME Aminopeptidase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8773 PE=1 SV=2
12	B0BCY9	2.26e-163	507	957	0.310	0.331	B0BCY9_HUMAN Aminopeptidase OS=Homo sapiens OX=9606 GN=ENPEP PE=2 SV=1
13	Q9JJ22	8.58e-163	505	930	0.290	0.319	ERAP1_RAT Endoplasmic reticulum aminopeptidase 1 OS=Rattus norvegicus OX=10116 GN=Erap1 PE=2 SV=2
14	B0BCZ2	3.55e-162	504	957	0.311	0.332	B0BCZ2_HUMAN Aminopeptidase OS=Homo sapiens OX=9606 GN=ENPEP PE=2 SV=1
15	B0BCZ6	8.20e-162	503	957	0.310	0.331	B0BCZ6_HUMAN Aminopeptidase OS=Homo sapiens OX=9606 GN=ENPEP PE=2 SV=1
16	B0BCY8	1.02e-161	503	957	0.310	0.331	B0BCY8_HUMAN Aminopeptidase OS=Homo sapiens OX=9606 GN=ENPEP PE=2 SV=1
17	Q07075	2.17e-161	502	957	0.310	0.331	AMPE_HUMAN Glutamyl aminopeptidase OS=Homo sapiens OX=9606 GN=ENPEP PE=1 SV=3
18	B0BCY7	2.47e-161	502	957	0.310	0.331	B0BCY7_HUMAN Aminopeptidase OS=Homo sapiens OX=9606 GN=ENPEP PE=2 SV=1
19	B0BCZ3	2.63e-161	502	957	0.310	0.331	B0BCZ3_HUMAN Aminopeptidase OS=Homo sapiens OX=9606 GN=ENPEP PE=2 SV=1
20	B0BCZ0	2.89e-161	502	957	0.310	0.331	B0BCZ0_HUMAN Aminopeptidase OS=Homo sapiens OX=9606 GN=ENPEP PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11838 ERAP1_C	7.3e-71	250.8	ERAP1-like C-terminal domain
2	PF01433 Peptidase_M1	9.3e-78	272.3	Peptidase family M1 domain
3	PF17900 Peptidase_M1_N	1.2e-56	203.3	Peptidase M1 N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261180

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000303452	0.782	Pro-thyrotropin-releasing hormone
2	9606.ENSP00000269919	0.724	Pyroglutamyl-peptidase 1
3	9606.ENSP00000328551	0.687	Ras-related protein Rab-28
4	9606.ENSP00000255476	0.680	Regulatory factor X-associated protein
5	9606.ENSP00000264029	0.626	Trehalase
6	9606.ENSP00000305071	0.624	DNA-binding protein RFXANK
7	9606.ENSP00000367755	0.575	Calmodulin-lysine N-methyltransferase
8	9606.ENSP00000296411	0.559	Methionine aminopeptidase 1
9	9606.ENSP00000223500	0.554	Charged multivesicular body protein 5
10	9606.ENSP00000358106	0.539	Prolyl endopeptidase
11	9606.ENSP00000361990	0.534	E3 ubiquitin-protein ligase UBR2
12	9606.ENSP00000411816	0.521	Chondroitin sulfate N-acetylgalactosaminyltransferase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004177	1.000	aminopeptidase activity
GO:0005488	0.963	binding
GO:0005515	0.870	protein binding
GO:0008237	0.710	metallopeptidase activity
GO:0043167	0.411	ion binding
GO:0008235	0.410	metalloexopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.991	organic substance metabolic process
GO:0044238	0.986	primary metabolic process
GO:0006807	0.983	nitrogen compound metabolic process
GO:1901564	0.962	organonitrogen compound metabolic process
GO:0009987	0.953	cellular process
GO:0019538	0.951	protein metabolic process
GO:0065007	0.816	biological regulation
GO:0050789	0.806	regulation of biological process
GO:0006508	0.777	proteolysis
GO:0050794	0.665	regulation of cellular process
GO:0050896	0.334	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0043227	0.999	membrane-bounded organelle
GO:0005576	0.986	extracellular region
GO:0070062	0.972	extracellular exosome
GO:0005886	0.967	plasma membrane
GO:0005737	0.961	cytoplasm
GO:0043229	0.928	intracellular organelle
GO:0043231	0.909	intracellular membrane-bounded organelle
GO:0031974	0.470	membrane-enclosed lumen
GO:0070013	0.459	intracellular organelle lumen
GO:0031090	0.439	organelle membrane
GO:0012505	0.343	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.11.-	1.000	Aminopeptidases.

[back to server]