StarFunc result for job id Q9UKU7

User Input

>input (415 residues)
MLWSGCRRFGARLGCLPGGLRVLVQTGHRSLTSCIDPSMGLNEEQKEFQKVAFDFAAREM
APNMAEWDQKELFPVDVMRKAAQLGFGGVYIQTDVGGSGLSRLDTSVIFEALATGCTSTT
AYISIHNMCAWMIDSFGNEEQRHKFCPPLCTMEKFASYCLTEPGSGSDAASLLTSAKKQG
DHYILNGSKAFISGAGESDIYVVMCRTGGPGPKGISCIVVEKGTPGLSFGKKEKKVGWNS
QPTRAVIFEDCAVPVANRIGSEGQGFLIAVRGLNGGRINIASCSLGAAHASVILTRDHLN
VRKQFGEPLASNQYLQFTLADMATRLVAARLMVRNAAVALQEERKDAVALCSMAKLFATD
ECFAICNQALQMHGGYGYLKDYAVQQYVRDSRVHQILEGSNEVMRILISRSLLQE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UKU7	1.000	1.000	4.229E-66	415	1.000	1.000	Q9UKU7.pdb.gz	ACAD8_HUMAN Isobutyryl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAD8 PE=1 SV=1
2	AFDB:Q9D7B6	0.934	0.939	1.440E-60	413	0.894	0.898	Q9D7B6.pdb.gz	ACAD8_MOUSE Isobutyryl-CoA dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Acad8 PE=1 SV=2
3	PDB:1rx0A	0.925	0.999	3.470E-59	384	0.925	1.000	1rx0A.pdb.gz	Structures of Isobutyryl-CoA Dehydrogenase and Enzyme-Product Complex: COMPARISON WITH ISOVALERYL- AND SHORT-CHAIN ACYL-COA DEHYDROGENASES.
4	AFDB:G3KIM8	0.886	0.933	3.298E-37	394	0.342	0.360	G3KIM8.pdb.gz	ACRC_ANAPI Acryloyl-CoA reductase (NADH) OS=Anaerotignum propionicum OX=28446 GN=acrC PE=1 SV=1
5	AFDB:Q3ZBF6	0.893	0.899	5.746E-35	412	0.342	0.345	Q3ZBF6.pdb.gz	ACADS_BOVIN Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Bos taurus OX=9913 GN=ACADS PE=1 SV=1
6	AFDB:E5KSD5	0.892	0.899	1.674E-34	412	0.340	0.342	E5KSD5.pdb.gz	E5KSD5_HUMAN Acyl-Coenzyme A dehydrogenase, C-2 to C-3 short chain OS=Homo sapiens OX=9606 GN=ACADS PE=3 SV=1
7	PDB:1jqiA	0.882	0.953	1.709E-34	384	0.340	0.367	1jqiA.pdb.gz	Crystal structure of rat short chain acyl-CoA dehydrogenase complexed with acetoacetyl-CoA: comparison with other acyl-CoA dehydrogenases.
8	AFDB:H6LGM6	0.887	0.970	6.752E-34	379	0.349	0.383	H6LGM6.pdb.gz	CARC_ACEWD Caffeyl-CoA reductase-Etf complex subunit CarC OS=Acetobacterium woodii (strain ATCC 29683 / DSM 1030 / JCM 2381 / KCTC 1655 / WB1) OX=931626 GN=carC PE=1 SV=1
9	AFDB:Q2LQN9	0.897	0.899	7.763E-34	414	0.337	0.338	Q2LQN9.pdb.gz	CH1CO_SYNAS Cyclohex-1-ene-1-carbonyl-CoA dehydrogenase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=SYN_02587 PE=1 SV=1
10	AFDB:A0A0S2Z3P9	0.888	0.854	1.126E-33	432	0.335	0.322	A0A0S2Z3P9.pdb.gz	A0A0S2Z3P9_HUMAN Acyl-CoA dehydrogenase short/branched chain isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=ACADSB PE=2 SV=1
11	AFDB:G5EEH6	0.897	0.889	1.633E-33	419	0.294	0.291	G5EEH6.pdb.gz	G5EEH6_CAEEL Isovaleryl-CoA dehydrogenase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=ivd-1 PE=1 SV=1
12	AFDB:P08503	0.881	0.868	2.600E-33	421	0.320	0.316	P08503.pdb.gz	ACADM_RAT Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acadm PE=1 SV=1
13	PDB:1ivhA	0.891	0.954	8.102E-33	387	0.296	0.318	1ivhA.pdb.gz	Structure of human isovaleryl-CoA dehydrogenase at 2.6 A resolution: structural basis for substrate specificity,.
14	PDB:6fahC	0.883	0.966	3.120E-32	379	0.349	0.383	6fahC.pdb.gz	Molecular basis of the flavin-based electron-bifurcating caffeyl-CoA reductase reaction.
15	PDB:2a1tC	0.877	0.937	1.019E-30	388	0.308	0.330	2a1tC.pdb.gz	Stabilization of Non-productive Conformations Underpins Rapid Electron Transfer to Electron-transferring Flavoprotein
16	PDB:6af6A	0.874	0.945	2.459E-28	383	0.246	0.266	6af6A.pdb.gz	Crystal Structure of PigA: A Prolyl Thioester-Oxidizing Enzyme in Prodigiosin Biosynthesis.
17	PDB:7s7gA	0.835	0.613	5.678E-28	571	0.284	0.207	7s7gA.pdb.gz	Crystal Structure Analysis of Human VLCAD
18	PDB:2ix6A	0.857	0.855	7.485E-26	416	0.227	0.226	2ix6A.pdb.gz	Controlling Electron Transfer in Acyl-Coa Oxidases and Dehydrogenases: A Structural View.
19	PDB:2r0mA	0.860	0.914	1.987E-25	390	0.229	0.244	2r0mA.pdb.gz	The effect of a Glu370Asp mutation in glutaryl-CoA dehydrogenase on proton transfer to the dienolate intermediate.
20	PDB:4xvxB	0.772	0.854	1.886E-21	373	0.186	0.206	4xvxB.pdb.gz	A covalent adduct of MbtN, an acyl-ACP dehydrogenase from Mycobacterium tuberculosis, reveals an unusual acyl-binding pocket.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9D7B6	0.0	776	413	0.894	0.898	ACAD8_MOUSE Isobutyryl-CoA dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Acad8 PE=1 SV=2
2	Q9UKU7	0.0	863	415	1.000	1.000	ACAD8_HUMAN Isobutyryl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAD8 PE=1 SV=1
3	G3KIM8	3.57e-91	282	394	0.347	0.365	ACRC_ANAPI Acryloyl-CoA reductase (NADH) OS=Anaerotignum propionicum OX=28446 GN=acrC PE=1 SV=1
4	P15651	3.22e-84	265	412	0.347	0.350	ACADS_RAT Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acads PE=1 SV=2
5	Q07417	5.39e-83	262	412	0.345	0.347	ACADS_MOUSE Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Acads PE=1 SV=2
6	H6LGM6	2.74e-82	259	379	0.357	0.391	CARC_ACEWD Caffeyl-CoA reductase-Etf complex subunit CarC OS=Acetobacterium woodii (strain ATCC 29683 / DSM 1030 / JCM 2381 / KCTC 1655 / WB1) OX=931626 GN=carC PE=1 SV=1
7	E5KSD5	3.42e-81	257	412	0.354	0.357	E5KSD5_HUMAN Acyl-Coenzyme A dehydrogenase, C-2 to C-3 short chain OS=Homo sapiens OX=9606 GN=ACADS PE=3 SV=1
8	P16219	3.42e-81	257	412	0.354	0.357	ACADS_HUMAN Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADS PE=1 SV=1
9	Q22347	2.08e-80	255	417	0.337	0.336	ACADM_CAEEL Probable medium-chain specific acyl-CoA dehydrogenase 10, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=acdh-10 PE=2 SV=1
10	P9WQG1	1.19e-76	244	389	0.325	0.347	ACDP_MYCTU Probable acyl-CoA dehydrogenase FadE25 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadE25 PE=1 SV=1
11	Q2LQN9	6.20e-76	244	414	0.330	0.331	CH1CO_SYNAS Cyclohex-1-ene-1-carbonyl-CoA dehydrogenase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=SYN_02587 PE=1 SV=1
12	P08503	6.27e-75	241	421	0.311	0.306	ACADM_RAT Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acadm PE=1 SV=1
13	P45952	7.61e-75	241	421	0.318	0.314	ACADM_MOUSE Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Acadm PE=1 SV=1
14	B7Z9I1	1.74e-74	239	385	0.306	0.330	B7Z9I1_HUMAN Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 PE=1 SV=1
15	A0A0S2Z366	1.95e-74	240	421	0.316	0.311	A0A0S2Z366_HUMAN Medium-chain specific acyl-CoA dehydrogenase, mitochondrial (Fragment) OS=Homo sapiens OX=9606 GN=ACADM PE=2 SV=1
16	P11310	1.95e-74	240	421	0.316	0.311	ACADM_HUMAN Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADM PE=1 SV=1
17	Q3ZBF6	3.91e-74	239	412	0.345	0.347	ACADS_BOVIN Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Bos taurus OX=9913 GN=ACADS PE=1 SV=1
18	Q9VSA3	3.82e-73	236	419	0.328	0.325	ACADM_DROME Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Mcad PE=1 SV=1
19	A0A0S2Z3P9	8.56e-69	226	432	0.330	0.317	A0A0S2Z3P9_HUMAN Acyl-CoA dehydrogenase short/branched chain isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=ACADSB PE=2 SV=1
20	P45954	8.56e-69	226	432	0.330	0.317	ACDSB_HUMAN Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADSB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00441 Acyl-CoA_dh_1	7.6e-39	144.8	Acyl-CoA dehydrogenase, C-terminal domain
2	PF08028 Acyl-CoA_dh_2	1.2e-16	72.6	Acyl-CoA dehydrogenase, C-terminal domain
3	PF02770 Acyl-CoA_dh_M	1.5e-22	90.9	Acyl-CoA dehydrogenase, middle domain
4	PF02771 Acyl-CoA_dh_N	4.6e-25	99.8	Acyl-CoA dehydrogenase, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000281182

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357535	0.949	Enoyl-CoA hydratase, mitochondrial
2	9606.ENSP00000231887	0.940	Peroxisomal bifunctional enzyme
3	9606.ENSP00000370023	0.940	Trifunctional enzyme subunit alpha, mitochondrial
4	9606.ENSP00000318351	0.931	2-oxoisovalerate dehydrogenase subunit beta, mitochondrial
5	9606.ENSP00000359151	0.925	Dihydrolipoamide branched chain transacylase E2
6	9606.ENSP00000269980	0.919	2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial
7	9606.ENSP00000205402	0.913	Dihydrolipoyl dehydrogenase, mitochondrial
8	9606.ENSP00000357873	0.900	Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial
9	9606.ENSP00000242592	0.861	Short-chain specific acyl-CoA dehydrogenase, mitochondrial
10	9606.ENSP00000285093	0.819	3-ketoacyl-CoA thiolase, mitochondrial
11	9606.ENSP00000452762	0.810	Electron transfer flavoprotein subunit alpha, mitochondrial
12	9606.ENSP00000044462	0.795	Proteasome subunit alpha type-4
13	9606.ENSP00000216455	0.792	Proteasome subunit alpha type-3
14	9606.ENSP00000261479	0.792	Proteasome subunit alpha type-6
15	9606.ENSP00000262193	0.792	Proteasome subunit beta type-1
16	9606.ENSP00000271308	0.792	Proteasome subunit alpha type-5
17	9606.ENSP00000362334	0.792	Proteasome subunit beta type-2
18	9606.ENSP00000414359	0.792	Proteasome subunit alpha type-1
19	9606.ENSP00000483688	0.792	Proteasome subunit beta type-3
20	9606.ENSP00000210313	0.788	26S proteasome non-ATPase regulatory subunit 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003995	1.000	acyl-CoA dehydrogenase activity
GO:0005488	0.991	binding
GO:0097159	0.914	organic cyclic compound binding
GO:0043168	0.868	anion binding
GO:0036094	0.857	small molecule binding
GO:1901363	0.852	heterocyclic compound binding
GO:0005515	0.819	protein binding
GO:0000166	0.636	nucleotide binding
GO:0050660	0.560	flavin adenine dinucleotide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.999	primary metabolic process
GO:0071704	0.998	organic substance metabolic process
GO:0006629	0.972	lipid metabolic process
GO:0009987	0.966	cellular process
GO:0044237	0.964	cellular metabolic process
GO:0044281	0.775	small molecule metabolic process
GO:0044255	0.622	cellular lipid metabolic process
GO:0019752	0.601	carboxylic acid metabolic process
GO:1901575	0.596	organic substance catabolic process
GO:0044248	0.559	cellular catabolic process
GO:0046395	0.501	carboxylic acid catabolic process
GO:0006631	0.493	fatty acid metabolic process
GO:0006807	0.438	nitrogen compound metabolic process
GO:0016042	0.428	lipid catabolic process
GO:0044242	0.408	cellular lipid catabolic process
GO:0009062	0.388	fatty acid catabolic process
GO:1901564	0.345	organonitrogen compound metabolic process
GO:0006635	0.316	fatty acid beta-oxidation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.998	intracellular organelle lumen
GO:0005759	0.910	mitochondrial matrix
GO:0005829	0.794	cytosol
GO:0005634	0.576	nucleus
GO:0032991	0.483	protein-containing complex
GO:0031981	0.302	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.3.-.-	1.000	Acting on the CH-CH group of donors.

[back to server]