StarFunc result for job id Q9UKV0

User Input

>input (1011 residues)
MHSMISSVDVKSEVPVGLEPISPLDLRTDLRMMMPVVDPVVREKQLQQELLLIQQQQQIQ
KQLLIAEFQKQHENLTRQHQAQLQEHIKELLAIKQQQELLEKEQKLEQQRQEQEVERHRR
EQQLPPLRGKDRGRERAVASTEVKQKLQEFLLSKSATKDTPTNGKNHSVSRHPKLWYTAA
HHTSLDQSSPPLSGTSPSYKYTLPGAQDAKDDFPLRKTASEPNLKVRSRLKQKVAERRSS
PLLRRKDGNVVTSFKKRMFEVTESSVSSSSPGSGPSSPNNGPTGSVTENETSVLPPTPHA
EQMVSQQRILIHEDSMNLLSLYTSPSLPNITLGLPAVPSQLNASNSLKEKQKCETQTLRQ
GVPLPGQYGGSIPASSSHPHVTLEGKPPNSSHQALLQHLLLKEQMRQQKLLVAGGVPLHP
QSPLATKERISPGIRGTHKLPRHRPLNRTQSAPLPQSTLAQLVIQQQHQQFLEKQKQYQQ
QIHMNKLLSKSIEQLKQPGSHLEEAEEELQGDQAMQEDRAPSSGNSTRSDSSACVDDTLG
QVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQPFLEPTHTRALSVRQAPLAAVGMDGL
EKHRLVSRTHSSPAASVLPHPAMDRPLQPGSATGIAYDPLMLKHQCVCGNSTTHPEHAGR
IQSIWSRLQETGLLNKCERIQGRKASLEEIQLVHSEHHSLLYGTNPLDGQKLDPRILLGD
DSQKFFSSLPCGGLGVDSDTIWNELHSSGAARMAVGCVIELASKVASGELKNGFAVVRPP
GHHAEESTAMGFCFFNSVAITAKYLRDQLNISKILIVDLDVHHGNGTQQAFYADPSILYI
SLHRYDEGNFFPGSGAPNEVGTGLGEGYNINIAWTGGLDPPMGDVEYLEAFRTIVKPVAK
EFDPDMVLVSAGFDALEGHTPPLGGYKVTAKCFGHLTKQLMTLADGRVVLALEGGHDLTA
ICDASEACVNALLGNELEPLAEDILHQSPNMNAVISLQKIIEIQSMSLKFS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E5RQ38	0.509	0.485	0.000	1068	0.919	0.870	E5RQ38.pdb.gz	E5RQ38_RAT Histone deacetylase OS=Rattus norvegicus OX=10116 GN=Hdac9 PE=2 SV=1
2	AFDB:E5RQ39	0.365	0.395	0.000	934	0.860	0.930	E5RQ39.pdb.gz	E5RQ39_RAT histone deacetylase (Fragment) OS=Rattus norvegicus OX=10116 GN=Hdac9 PE=2 SV=1
3	AFDB:A0A0R4IAH0	0.460	0.443	1.294E-82	1052	0.541	0.520	A0A0R4IAH0.pdb.gz	A0A0R4IAH0_DANRE Histone deacetylase OS=Danio rerio OX=7955 GN=wu:fa96d08 PE=1 SV=1
4	AFDB:J3KPH8	0.379	0.378	4.658E-68	1014	0.416	0.415	J3KPH8.pdb.gz	J3KPH8_HUMAN Histone deacetylase OS=Homo sapiens OX=9606 GN=HDAC7 PE=1 SV=1
5	AFDB:Q8C2B3	0.376	0.404	5.377E-66	938	0.409	0.440	Q8C2B3.pdb.gz	HDAC7_MOUSE Histone deacetylase 7 OS=Mus musculus OX=10090 GN=Hdac7 PE=1 SV=2
6	PDB:5eduB	0.323	0.448	1.622E-38	723	0.158	0.221	5eduB.pdb.gz	Histone deacetylase 6 structure and molecular basis of catalysis and inhibition.
7	PDB:7sggA	0.325	0.506	3.363E-34	644	0.126	0.197	7sggA.pdb.gz	Aza-SAHA Derivatives Are Selective Histone Deacetylase 10 Chemical Probes That Inhibit Polyamine Deacetylation and Phenocopy HDAC10 Knockout.
8	PDB:6z6fB	0.324	0.488	1.197E-33	661	0.144	0.221	6z6fB.pdb.gz	Structural basis for the regulation of nucleosome recognition and HDAC activity by histone deacetylase assemblies.
9	PDB:6uijA	0.328	0.529	5.318E-33	620	0.125	0.203	6uijA.pdb.gz	Binding ofN8-Acetylspermidine Analogues to Histone Deacetylase 10 Reveals Molecular Strategies for Blocking Polyamine Deacetylation.
10	PDB:5ikkA	0.291	0.485	3.289E-32	594	0.136	0.231	5ikkA.pdb.gz	SHREC Silences Heterochromatin via Distinct Remodeling and Deacetylation Modules.
11	PDB:5g0yB	0.311	0.783	7.086E-29	377	0.106	0.284	5g0yB.pdb.gz	Crystal Structure of a Histone Deacetylase Homologue from Pseudomonas aeruginosa.
12	AFDB:Q6PBI4	0.094	0.152	1.190E-27	582	0.339	0.589	Q6PBI4.pdb.gz	HDA9B_DANRE Histone deacetylase 9-B OS=Danio rerio OX=7955 GN=hdac9b PE=2 SV=1
13	PDB:3sfhA	0.279	0.773	6.742E-22	342	0.083	0.246	3sfhA.pdb.gz	Human HDAC isoform selectivity achieved via exploitation of the acetate release channel with structurally unique small molecule inhibitors.
14	PDB:4qa0A	0.295	0.756	8.885E-22	371	0.081	0.221	4qa0A.pdb.gz	Compromised Structure and Function of HDAC8 Mutants Identified in Cornelia de Lange Syndrome Spectrum Disorders.
15	PDB:7zzuB	0.302	0.779	1.049E-21	371	0.089	0.243	7zzuB.pdb.gz	Fragment-Based Discovery of a Novel, Brain Penetrant, Orally Active HDAC2 Inhibitor.
16	PDB:5zeeB	0.147	0.409	5.434E-5	297	0.032	0.108	5zeeB.pdb.gz	Structural insights into Entamoeba histolytica arginase and structure-based identification of novel non-amino acid based inhibitors as potential antiamoebic molecules.
17	AFDB:Q2M2Z5	0.075	0.099	3.250E-3	673	0.089	0.134	Q2M2Z5.pdb.gz	KIZ_HUMAN Centrosomal protein kizuna OS=Homo sapiens OX=9606 GN=KIZ PE=1 SV=2
18	AFDB:Q9UQB3	0.049	0.042	2.800E-2	1225	0.107	0.088	Q9UQB3.pdb.gz	CTND2_HUMAN Catenin delta-2 OS=Homo sapiens OX=9606 GN=CTNND2 PE=1 SV=3
19	AFDB:Q5W0B1	0.064	0.084	5.740E-2	726	0.088	0.123	Q5W0B1.pdb.gz	OBI1_HUMAN ORC ubiquitin ligase 1 OS=Homo sapiens OX=9606 GN=OBI1 PE=1 SV=1
20	AFDB:Q9SE97	0.049	0.048	5.740E-2	1051	0.123	0.118	Q9SE97.pdb.gz	FH1_ARATH Formin-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=FH1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K082	1662	1043	0.893	0.866	A0A0G2K082_RAT Histone deacetylase OS=Rattus norvegicus OX=10116 GN=Hdac9 PE=3 SV=2
2	A0A0R4IAH0	982	1052	0.558	0.536	A0A0R4IAH0_DANRE Histone deacetylase OS=Danio rerio OX=7955 GN=wu:fa96d08 PE=1 SV=1
3	A0A8I5XW09	968	1089	0.595	0.553	A0A8I5XW09_RAT Histone deacetylase OS=Rattus norvegicus OX=10116 GN=Hdac5 PE=3 SV=1
4	A0A8I5ZWP6	1621	1024	0.879	0.868	A0A8I5ZWP6_RAT Histone deacetylase OS=Rattus norvegicus OX=10116 GN=Hdac9 PE=3 SV=1
5	A0A8I6AB01	786	568	0.473	0.842	A0A8I6AB01_RAT histone deacetylase OS=Rattus norvegicus OX=10116 GN=Hdac9 PE=3 SV=1
6	A0A8I6G4R8	969	1114	0.605	0.549	A0A8I6G4R8_RAT Histone deacetylase OS=Rattus norvegicus OX=10116 GN=Hdac5 PE=3 SV=1
7	E5RQ38	1730	1068	0.921	0.872	E5RQ38_RAT Histone deacetylase OS=Rattus norvegicus OX=10116 GN=Hdac9 PE=2 SV=1
8	E5RQ39	1585	934	0.860	0.930	E5RQ39_RAT histone deacetylase (Fragment) OS=Rattus norvegicus OX=10116 GN=Hdac9 PE=2 SV=1
9	E7FH14	1040	1128	0.613	0.550	E7FH14_DANRE Histone deacetylase OS=Danio rerio OX=7955 GN=hdac5 PE=3 SV=2
10	F1LM64	912	970	0.532	0.555	F1LM64_RAT Histone deacetylase OS=Rattus norvegicus OX=10116 GN=Hdac5 PE=1 SV=4
11	J3KPH8	619	1014	0.416	0.415	J3KPH8_HUMAN Histone deacetylase OS=Homo sapiens OX=9606 GN=HDAC7 PE=1 SV=1
12	P56524	1014	1084	0.589	0.549	HDAC4_HUMAN Histone deacetylase 4 OS=Homo sapiens OX=9606 GN=HDAC4 PE=1 SV=3
13	P83038	1029	1080	0.595	0.557	HDAC4_CHICK Histone deacetylase 4 OS=Gallus gallus OX=9031 GN=HDAC4 PE=2 SV=1
14	Q08BS8	979	1023	0.556	0.549	Q08BS8_DANRE Histone deacetylase OS=Danio rerio OX=7955 GN=zgc:152701 PE=1 SV=1
15	Q6NZM9	989	1076	0.571	0.536	HDAC4_MOUSE Histone deacetylase 4 OS=Mus musculus OX=10090 GN=Hdac4 PE=1 SV=1
16	Q8C2B3	584	938	0.279	0.301	HDAC7_MOUSE Histone deacetylase 7 OS=Mus musculus OX=10090 GN=Hdac7 PE=1 SV=2
17	Q8WUI4	580	952	0.275	0.292	HDAC7_HUMAN Histone deacetylase 7 OS=Homo sapiens OX=9606 GN=HDAC7 PE=1 SV=2
18	Q99N13	918	588	0.537	0.923	HDAC9_MOUSE Histone deacetylase 9 OS=Mus musculus OX=10090 GN=Hdac9 PE=1 SV=2
19	Q99P99	990	1077	0.576	0.540	HDAC4_RAT Histone deacetylase 4 OS=Rattus norvegicus OX=10116 GN=Hdac4 PE=1 SV=2
20	Q9UKV0	2072	1011	1.000	1.000	HDAC9_HUMAN Histone deacetylase 9 OS=Homo sapiens OX=9606 GN=HDAC9 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12203 HDAC4_Gln	9.2e-29	110.8	Glutamine rich N terminal domain of histone deacetylase 4
2	PF00850 Hist_deacetyl	6.4e-84	293.5	Histone deacetylase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9544.ENSMMUP00000014626

Rank	PPI partner	STRING score	Description
1	9544.ENSMMUP00000021949	0.941	Myocyte-specific enhancer factor 2D
2	9544.ENSMMUP00000026081	0.933	Myocyte-specific enhancer factor 2C isoform 1
3	9544.ENSMMUP00000024153	0.907	Myocyte enhancer factor 2B
4	9544.ENSMMUP00000023816	0.899	Myocyte-specific enhancer factor 2A isoform 2
5	9544.ENSMMUP00000003403	0.896	Nuclear receptor corepressor 1
6	9544.ENSMMUP00000026056	0.860	Runt-related transcription factor 2
7	9544.ENSMMUP00000023533	0.823	Histone deacetylase
8	9544.ENSMMUP00000013015	0.818	Histone deacetylase
9	9544.ENSMMUP00000027639	0.812	Hypoxia-inducible factor 1-alpha isoform 1
10	9544.ENSMMUP00000011189	0.807	Uncharacterized protein
11	9544.ENSMMUP00000026085	0.804	Histone acetyltransferase
12	9544.ENSMMUP00000038418	0.804	Nuclear receptor corepressor 2
13	9544.ENSMMUP00000035809	0.785	Uncharacterized protein
14	9544.ENSMMUP00000011309	0.750	Forkhead box protein P3
15	9544.ENSMMUP00000033350	0.744	Uncharacterized protein
16	9544.ENSMMUP00000001937	0.737	Belongs to the histone H2A family.
17	9544.ENSMMUP00000027658	0.735	RAN binding protein 2
18	9544.ENSMMUP00000013010	0.727	Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein eta
19	9544.ENSMMUP00000015797	0.727	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
20	9544.ENSMMUP00000011716	0.726	Histone deacetylase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004407	1.000	histone deacetylase activity
GO:0140297	0.999	DNA-binding transcription factor binding
GO:0003682	0.932	chromatin binding
GO:0140110	0.903	transcription regulator activity
GO:0019899	0.883	enzyme binding
GO:0003677	0.871	DNA binding
GO:0003712	0.819	transcription coregulator activity
GO:0003714	0.698	transcription corepressor activity
GO:0043565	0.666	sequence-specific DNA binding
GO:0003690	0.575	double-stranded DNA binding
GO:1990837	0.572	sequence-specific double-stranded DNA binding
GO:0000976	0.561	transcription cis-regulatory region binding
GO:0061629	0.501	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0000977	0.461	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0043167	0.448	ion binding
GO:0042826	0.352	histone deacetylase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0032501	0.961	multicellular organismal process
GO:0032502	0.959	developmental process
GO:0048869	0.947	cellular developmental process
GO:0065007	0.944	biological regulation
GO:0048856	0.937	anatomical structure development
GO:0050789	0.892	regulation of biological process
GO:0050896	0.888	response to stimulus
GO:0008152	0.797	metabolic process
GO:0042221	0.706	response to chemical
GO:0030154	0.693	cell differentiation
GO:0007275	0.691	multicellular organism development
GO:0010033	0.649	response to organic substance
GO:0048731	0.644	system development
GO:0048519	0.633	negative regulation of biological process
GO:0010243	0.555	response to organonitrogen compound
GO:0050794	0.514	regulation of cellular process
GO:0044237	0.354	cellular metabolic process
GO:0044238	0.344	primary metabolic process
GO:0071704	0.339	organic substance metabolic process
GO:0071840	0.336	cellular component organization or biogenesis
GO:0019222	0.327	regulation of metabolic process
GO:0016043	0.325	cellular component organization
GO:0031323	0.310	regulation of cellular metabolic process
GO:0060255	0.309	regulation of macromolecule metabolic process
GO:0080090	0.307	regulation of primary metabolic process
GO:0051171	0.307	regulation of nitrogen compound metabolic process
GO:0010468	0.300	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0032991	0.991	protein-containing complex
GO:0005654	0.990	nucleoplasm
GO:0005737	0.426	cytoplasm
GO:0016020	0.377	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:58196	1.000	H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone]
EC:3.5.1.98	1.000	histone deacetylase.

[back to server]