StarFunc result for job id Q9UKV3

User Input

>input (1341 residues)
MWRRKHPRTSGGTRGVLSGNRGVEYGSGRGHLGTFEGRWRKLPKMPEAVGTDPSTSRKMA
ELEEVTLDGKPLQALRVTDLKAALEQRGLAKSGQKSALVKRLKGALMLENLQKHSTPHAA
FQPNSQIGEEMSQNSFIKQYLEKQQELLRQRLEREAREAAELEEASAESEDEMIHPEGVA
SLLPPDFQSSLERPELELSRHSPRKSSSISEEKGDSDDEKPRKGERRSSRVRQARAAKLS
EGSQPAEEEEDQETPSRNLRVRADRNLKTEEEEEEEEEEEEDDEEEEGDDEGQKSREAPI
LKEFKEEGEEIPRVKPEEMMDERPKTRSQEQEVLERGGRFTRSQEEARKSHLARQQQEKE
MKTTSPLEEEEREIKSSQGLKEKSKSPSPPRLTEDRKKASLVALPEQTASEEETPPPLLT
KEASSPPPHPQLHSEEEIEPMEGPAPAVLIQLSPPNTDADTRELLVSQHTVQLVGGLSPL
SSPSDTKAESPAEKVPEESVLPLVQKSTLADYSAQKDLEPESDRSAQPLPLKIEELALAK
GITEECLKQPSLEQKEGRRASHTLLPSHRLKQSADSSSSRSSSSSSSSSRSRSRSPDSSG
SRSHSPLRSKQRDVAQARTHANPRGRPKMGSRSTSESRSRSRSRSRSASSNSRKSLSPGV
SRDSSTSYTETKDPSSGQEVATPPVPQLQVCEPKERTSTSSSSVQARRLSQPESAEKHVT
QRLQPERGSPKKCEAEEAEPPAATQPQTSETQTSHLPESERIHHTVEEKEEVTMDTSENR
PENDVPEPPMPIADQVSNDDRPEGSVEDEEKKESSLPKSFKRKISVVSATKGVPAGNSDT
EGGQPGRKRRWGASTATTQKKPSISITTESLKSLIPDIKPLAGQEAVVDLHADDSRISED
ETERNGDDGTHDKGLKICRTVTQVVPAEGQENGQREEEEEEKEPEAEPPVPPQVSVEVAL
PPPAEHEVKKVTLGDTLTRRSISQQKSGVSITIDDPVRTAQVPSPPRGKISNIVHISNLV
RPFTLGQLKELLGRTGTLVEEAFWIDKIKSHCFVTYSTVEEAVATRTALHGVKWPQSNPK
FLCADYAEQDELDYHRGLLVDRPSETKTEEQGIPRPLHPPPPPPVQPPQHPRAEQREQER
AVREQWAEREREMERRERTRSEREWDRDKVREGPRSRSRSRDRRRKERAKSKEKKSEKKE
KAQEEPPAKLLDDLFRKTKAAPCIYWLPLTDSQIVQKEAERAERAKEREKRRKEQEEEEQ
KEREKEAERERNRQLEREKRREHSRERDRERERERERDRGDRDRDRERDRERGRERDRRD
TKRHSRSRSRSTPVRDRGGRR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9JIX8	0.311	0.312	0.000	1338	0.862	0.864	Q9JIX8.pdb.gz	ACINU_MOUSE Apoptotic chromatin condensation inducer in the nucleus OS=Mus musculus OX=10090 GN=Acin1 PE=1 SV=3
2	AFDB:Q9UKV3	1.000	1.000	0.000	1341	1.000	1.000	Q9UKV3.pdb.gz	ACINU_HUMAN Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1 PE=1 SV=2
3	AFDB:Q3UHK8	0.066	0.049	4.296E-6	1896	0.129	0.091	Q3UHK8.pdb.gz	TNR6A_MOUSE Trinucleotide repeat-containing gene 6A protein OS=Mus musculus OX=10090 GN=Tnrc6a PE=1 SV=2
4	PDB:3lqvB	0.061	0.598	3.455E-5	115	0.015	0.174	3lqvB.pdb.gz	Branch Recognition by SF3b14
5	PDB:6exnY	0.055	0.717	1.323E-4	87	0.011	0.172	6exnY.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
6	AFDB:Q8VHJ7	0.056	0.073	2.565E-4	1014	0.116	0.154	Q8VHJ7.pdb.gz	PRGC2_MOUSE Peroxisome proliferator-activated receptor gamma coactivator 1-beta OS=Mus musculus OX=10090 GN=Ppargc1b PE=1 SV=1
7	PDB:3pgwP	0.059	0.576	3.306E-4	113	0.013	0.159	3pgwP.pdb.gz
8	PDB:6ff7X	0.055	0.352	5.726E-4	171	0.015	0.117	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
9	PDB:1hl6A	0.056	0.561	6.877E-4	119	0.012	0.134	1hl6A.pdb.gz
10	PDB:7dvqY	0.055	0.477	7.310E-4	140	0.012	0.114	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
11	PDB:5xjcw	0.056	0.709	9.331E-4	91	0.012	0.176	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
12	PDB:6gd1A	0.053	0.344	9.331E-4	190	0.015	0.105	6gd1A.pdb.gz
13	PDB:5gm6V	0.055	0.487	9.919E-4	128	0.012	0.125	5gm6V.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
14	PDB:6lurD	0.058	0.323	9.919E-4	213	0.013	0.085	6lurD.pdb.gz	Revisiting biomolecular NMR spectroscopy for promoting small-molecule drug discovery.
15	AFDB:F1LV37	0.066	0.049	1.110E-3	1818	0.121	0.089	F1LV37.pdb.gz	F1LV37_RAT Trinucleotide repeat containing adaptor 6B OS=Rattus norvegicus OX=10116 GN=Tnrc6b PE=1 SV=3
16	AFDB:Q8NDV7	0.065	0.046	2.044E-3	1962	0.132	0.090	Q8NDV7.pdb.gz	TNR6A_HUMAN Trinucleotide repeat-containing gene 6A protein OS=Homo sapiens OX=9606 GN=TNRC6A PE=1 SV=2
17	AFDB:Q13029	0.053	0.045	3.133E-3	1718	0.146	0.114	Q13029.pdb.gz	PRDM2_HUMAN PR domain zinc finger protein 2 OS=Homo sapiens OX=9606 GN=PRDM2 PE=1 SV=3
18	AFDB:Q15032	0.049	0.058	3.330E-3	1099	0.097	0.118	Q15032.pdb.gz	R3HD1_HUMAN R3H domain-containing protein 1 OS=Homo sapiens OX=9606 GN=R3HDM1 PE=1 SV=3
19	AFDB:Q5VV67	0.059	0.051	4.251E-3	1664	0.132	0.106	Q5VV67.pdb.gz	PPRC1_HUMAN Peroxisome proliferator-activated receptor gamma coactivator-related protein 1 OS=Homo sapiens OX=9606 GN=PPRC1 PE=1 SV=1
20	AFDB:Q9UPQ9	0.066	0.049	7.364E-3	1833	0.130	0.095	Q9UPQ9.pdb.gz	TNR6B_HUMAN Trinucleotide repeat-containing gene 6B protein OS=Homo sapiens OX=9606 GN=TNRC6B PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7EQT4	0.0	2543	1301	0.969	0.999	E7EQT4_HUMAN Apoptotic chromatin condensation inducer 1 OS=Homo sapiens OX=9606 GN=ACIN1 PE=1 SV=2
2	G3V3B0	0.0	1144	582	0.428	0.986	G3V3B0_HUMAN Apoptotic chromatin condensation inducer 1 OS=Homo sapiens OX=9606 GN=ACIN1 PE=1 SV=1
3	Q9JIX8	0.0	1642	1338	0.790	0.791	ACINU_MOUSE Apoptotic chromatin condensation inducer in the nucleus OS=Mus musculus OX=10090 GN=Acin1 PE=1 SV=3
4	Q9UKV3	0.0	2644	1341	1.000	1.000	ACINU_HUMAN Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1 PE=1 SV=2
5	S4R3H4	0.0	2520	1283	0.957	1.000	S4R3H4_HUMAN Apoptotic chromatin condensation inducer 1 OS=Homo sapiens OX=9606 GN=ACIN1 PE=1 SV=1
6	Q9VJ12	2.90e-44	175	739	0.089	0.162	Q9VJ12_DROME Acinus, isoform A OS=Drosophila melanogaster OX=7227 GN=Acn PE=1 SV=1
7	Q8MRH4	9.11e-31	132	601	0.048	0.106	Q8MRH4_DROME LD46360p OS=Drosophila melanogaster OX=7227 GN=Acn PE=2 SV=1
8	P91156	1.76e-17	90.1	580	0.030	0.069	P91156_CAEEL SAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=acin-1 PE=1 SV=2
9	O65655	2.20e-17	90.1	633	0.026	0.055	O65655_ARATH SAP domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At4g39680 PE=1 SV=1
10	F1QBY1	1.07e-07	59.3	2876	0.051	0.024	NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio OX=7955 GN=nipblb PE=2 SV=1
11	O23212	8.99e-05	49.3	573	0.025	0.058	U2A2A_ARATH Splicing factor U2af large subunit A OS=Arabidopsis thaliana OX=3702 GN=U2AF65A PE=1 SV=2
12	F4JQG2	9.12e-05	49.3	551	0.025	0.060	F4JQG2_ARATH Splicing factor U2af large subunit OS=Arabidopsis thaliana OX=3702 GN=ATU2AF65A PE=1 SV=1
13	Q4QRG7	0.010	42.4	434	0.025	0.078	Q4QRG7_DANRE RNA-binding motif protein, X-linked 2 OS=Danio rerio OX=7955 GN=zgc:113884 PE=2 SV=1
14	F1RAH8	0.037	40.8	450	0.024	0.071	F1RAH8_DANRE RNA-binding motif protein X-linked 2 OS=Danio rerio OX=7955 GN=im:7141316 PE=4 SV=1
15	A5PJP2	0.072	40.0	903	0.014	0.021	A5PJP2_BOVIN SAFB protein OS=Bos taurus OX=9913 GN=SAFB PE=2 SV=1
16	Q5LJZ2	0.083	40.0	1641	0.032	0.026	SET1_DROME Histone-lysine N-methyltransferase SETD1 OS=Drosophila melanogaster OX=7227 GN=Set1 PE=1 SV=1
17	O62203	0.11	39.3	1073	0.018	0.022	PHM2_CAEEL Pharyngeal muscle protein 2 OS=Caenorhabditis elegans OX=6239 GN=phm-2 PE=1 SV=3
18	Q9NWH9	0.11	39.3	1034	0.013	0.017	SLTM_HUMAN SAFB-like transcription modulator OS=Homo sapiens OX=9606 GN=SLTM PE=1 SV=2
19	Q6PGZ3	0.24	38.1	629	0.019	0.041	MIPT3_DANRE TRAF3-interacting protein 1 OS=Danio rerio OX=7955 GN=traf3ip1 PE=2 SV=1
20	Q8IGV1	0.26	38.1	977	0.015	0.020	Q8IGV1_DROME RE24907p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Saf-B PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00076 RRM_1	1.9e+02	13.3	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
2	PF16294 RSB_motif	1e-21	88.4	RNSP1-SAP18 binding (RSB) motif
3	PF02037 SAP	5.7e-05	34.0	SAP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262710

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000457723	0.999	RNA-binding protein with serine-rich domain 1
2	9606.ENSP00000481842	0.999	Histone deacetylase complex subunit SAP18
3	9606.ENSP00000431391	0.975	Apoptosis inhibitor 5
4	9606.ENSP00000301740	0.955	Serine/arginine repetitive matrix protein 2
5	9606.ENSP00000311032	0.951	Caspase-3
6	9606.ENSP00000283179	0.898	Heterogeneous nuclear ribonucleoprotein U
7	9606.ENSP00000377262	0.844	SRSF protein kinase 2
8	9606.ENSP00000216832	0.802	Pinin
9	9606.ENSP00000339524	0.775	DNA fragmentation factor subunit beta
10	9606.ENSP00000416951	0.759	Zinc finger CCCH-type containing 18
11	9606.ENSP00000360525	0.756	Protein mago nashi homolog
12	9606.ENSP00000326261	0.750	Serine/arginine repetitive matrix protein 1
13	9606.ENSP00000362931	0.750	SRSF protein kinase 1
14	9606.ENSP00000269349	0.747	Eukaryotic initiation factor 4A-III
15	9606.ENSP00000249636	0.746	E3 SUMO-protein ligase PIAS1
16	9606.ENSP00000296215	0.737	Smad nuclear-interacting protein 1
17	9606.ENSP00000364289	0.731	Nuclear cap-binding protein subunit 1
18	9606.ENSP00000386458	0.731	Pre-mRNA-processing factor 40 homolog A
19	9606.ENSP00000467423	0.715	Scaffold attachment factor B1
20	9606.ENSP00000319240	0.673	Protein mago nashi homolog 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003677	0.365	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050789	0.987	regulation of biological process
GO:0050794	0.979	regulation of cellular process
GO:0019219	0.969	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.966	regulation of gene expression
GO:0048518	0.964	positive regulation of biological process
GO:0051252	0.962	regulation of RNA metabolic process
GO:0048519	0.942	negative regulation of biological process
GO:0048522	0.940	positive regulation of cellular process
GO:0016043	0.929	cellular component organization
GO:0032502	0.856	developmental process
GO:0010605	0.850	negative regulation of macromolecule metabolic process
GO:0048523	0.848	negative regulation of cellular process
GO:1903311	0.837	regulation of mRNA metabolic process
GO:0032501	0.836	multicellular organismal process
GO:0051239	0.761	regulation of multicellular organismal process
GO:0048856	0.759	anatomical structure development
GO:0043484	0.648	regulation of RNA splicing
GO:0050684	0.639	regulation of mRNA processing
GO:0051172	0.628	negative regulation of nitrogen compound metabolic process
GO:0031324	0.627	negative regulation of cellular metabolic process
GO:0045934	0.492	negative regulation of nucleobase-containing compound metabolic process
GO:0010629	0.471	negative regulation of gene expression
GO:0071704	0.432	organic substance metabolic process
GO:0030154	0.425	cell differentiation
GO:0006996	0.413	organelle organization
GO:0048024	0.406	regulation of mRNA splicing, via spliceosome
GO:0051253	0.402	negative regulation of RNA metabolic process
GO:0044238	0.387	primary metabolic process
GO:0042981	0.382	regulation of apoptotic process
GO:0006807	0.378	nitrogen compound metabolic process
GO:0043170	0.377	macromolecule metabolic process
GO:0044237	0.362	cellular metabolic process
GO:1903312	0.354	negative regulation of mRNA metabolic process
GO:0050686	0.343	negative regulation of mRNA processing
GO:0033119	0.336	negative regulation of RNA splicing
GO:0043068	0.317	positive regulation of programmed cell death
GO:0043065	0.314	positive regulation of apoptotic process
GO:0090304	0.305	nucleic acid metabolic process
GO:0002376	0.301	immune system process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0016020	0.999	membrane
GO:0005829	0.998	cytosol
GO:0005886	0.993	plasma membrane
GO:0032991	0.962	protein-containing complex
GO:0043232	0.945	intracellular non-membrane-bounded organelle
GO:0016604	0.938	nuclear body
GO:0016607	0.893	nuclear speck
GO:0140513	0.830	nuclear protein-containing complex
GO:0061574	0.389	ASAP complex
GO:0005730	0.385	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]