StarFunc result for job id Q9UKV5

User Input

>input (643 residues)
MPLLFLERFPWPSLRTYTGLSGLALLGTIISAYRALSQPEAGPGEPDQLTASLQPEPPAP
ARPSAGGPRARDVAQYLLSDSLFVWVLVNTACCVLMLVAKLIQCIVFGPLRVSERQHLKD
KFWNFIFYKFIFIFGVLNVQTVEEVVMWCLWFAGLVFLHLMVQLCKDRFEYLSFSPTTPM
SSHGRVLSLLVAMLLSCCGLAAVCSITGYTHGMHTLAFMAAESLLVTVRTAHVILRYVIH
LWDLNHEGTWEGKGTYVYYTDFVMELTLLSLDLMHHIHMLLFGNIWLSMASLVIFMQLRY
LFHEVQRRIRRHKNYLRVVGNMEARFAVATPEELAVNNDDCAICWDSMQAARKLPCGHLF
HNSCLRSWLEQDTSCPTCRMSLNIADNNRVREEHQGENLDENLVPVAAAEGRPRLNQHNH
FFHFDGSRIASWLPSFSVEVMHTTNILGITQASNSQLNAMAHQIQEMFPQVPYHLVLQDL
QLTRSVEITTDNILEGRIQVPFPTQRSDSIRPALNSPVERPSSDQEEGETSAQTERVPLD
LSPRLEETLDFGEVEVEPSEVEDFEARGSRFSKSADERQRMLVQRKDELLQQARKRFLNK
SSEDDAASESFLPSEGASSDPVTLRRRMLAAAAERRLQKQQTS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9R049	0.676	0.676	5.622E-79	643	0.944	0.944	Q9R049.pdb.gz	AMFR_MOUSE E3 ubiquitin-protein ligase AMFR OS=Mus musculus OX=10090 GN=Amfr PE=1 SV=2
2	AFDB:F1QB30	0.643	0.665	1.664E-59	620	0.692	0.718	F1QB30.pdb.gz	F1QB30_DANRE Autocrine motility factor receptor a OS=Danio rerio OX=7955 GN=amfr PE=4 SV=1
3	AFDB:P90859	0.463	0.520	1.447E-21	564	0.198	0.225	P90859.pdb.gz	HRDL1_CAEEL E3 ubiquitin-protein ligase hrd-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=hrdl-1 PE=1 SV=2
4	AFDB:Q9LW77	0.461	0.586	3.511E-20	492	0.188	0.246	Q9LW77.pdb.gz	HRD1A_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1A OS=Arabidopsis thaliana OX=3702 GN=HRD1A PE=2 SV=1
5	AFDB:R4GNG2	0.103	0.204	3.381E-19	299	0.347	0.746	R4GNG2.pdb.gz	R4GNG2_HUMAN Autocrine motility factor receptor (Fragment) OS=Homo sapiens OX=9606 GN=AMFR PE=1 SV=1
6	AFDB:Q6NPT7	0.448	0.608	1.178E-18	460	0.185	0.259	Q6NPT7.pdb.gz	HRD1B_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1B OS=Arabidopsis thaliana OX=3702 GN=HRD1B PE=2 SV=1
7	AFDB:Q8VYC8	0.491	0.543	1.484E-18	578	0.212	0.235	Q8VYC8.pdb.gz	RIN2_ARATH E3 ubiquitin protein ligase RIN2 OS=Arabidopsis thaliana OX=3702 GN=RIN2 PE=1 SV=1
8	AFDB:F4KD92	0.479	0.514	4.935E-18	595	0.199	0.215	F4KD92.pdb.gz	F4KD92_ARATH RPM1 interacting protein 3 OS=Arabidopsis thaliana OX=3702 GN=RIN3 PE=1 SV=1
9	AFDB:Q95SP2	0.448	0.458	9.872E-18	626	0.190	0.195	Q95SP2.pdb.gz	HRD1_DROME E3 ubiquitin-protein ligase HRD1 OS=Drosophila melanogaster OX=7227 GN=sip3 PE=1 SV=1
10	AFDB:Q20798	0.401	0.419	2.068E-17	610	0.196	0.207	Q20798.pdb.gz	HRD1_CAEEL E3 ubiquitin-protein ligase hrd-1 OS=Caenorhabditis elegans OX=6239 GN=sel-11 PE=3 SV=1
11	PDB:7oikA	0.107	0.027	8.711E-2	4426	0.087	0.013	7oikA.pdb.gz	E3 ubiquitin ligase RNF213 employs a non-canonical zinc finger active site and is allosterically regulated by ATP
12	PDB:3m62A	0.113	0.087	1.448E-1	955	0.076	0.051	3m62A.pdb.gz
13	PDB:6vn7R	0.123	0.236	3.485E-1	263	0.048	0.118	6vn7R.pdb.gz	Cryo-EM structure of an activated VIP1 receptor-G protein complex revealed by a NanoBiT tethering strategy.
14	PDB:6hivDH	0.124	0.135	4.599E-1	564	0.106	0.121	6hivDH.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
15	PDB:5sv0A	0.060	0.128	6.972E-1	233	0.039	0.107	5sv0A.pdb.gz
16	PDB:4o9yA	0.095	0.028	8.009E-1	2490	0.040	0.010	4o9yA.pdb.gz
17	PDB:5oqj1	0.149	0.191	8.388E-1	491	0.034	0.045	5oqj1.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
18	PDB:7d3sR	0.134	0.258	9.635E-1	266	0.054	0.132	7d3sR.pdb.gz	Structure of the human secretin receptor coupled to an engineered heterotrimeric G protein.
19	PDB:5mg3D	0.134	0.183	1.159	414	0.034	0.053	5mg3D.pdb.gz
20	PDB:7p54A	0.059	0.083	1.214	397	0.058	0.093	7p54A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K437	0.0	1205	770	0.935	0.781	A0A0G2K437_RAT Autocrine motility factor receptor OS=Rattus norvegicus OX=10116 GN=Amfr PE=1 SV=2
2	F1QB30	0.0	829	620	0.701	0.727	F1QB30_DANRE Autocrine motility factor receptor a OS=Danio rerio OX=7955 GN=amfr PE=4 SV=1
3	Q6PFU8	0.0	830	620	0.703	0.729	Q6PFU8_DANRE Autocrine motility factor receptor OS=Danio rerio OX=7955 GN=amfr PE=2 SV=1
4	Q9R049	0.0	1239	643	0.944	0.944	AMFR_MOUSE E3 ubiquitin-protein ligase AMFR OS=Mus musculus OX=10090 GN=Amfr PE=1 SV=2
5	Q9UKV5	0.0	1333	643	1.000	1.000	AMFR_HUMAN E3 ubiquitin-protein ligase AMFR OS=Homo sapiens OX=9606 GN=AMFR PE=1 SV=2
6	R4GNG2	6.95e-147	429	299	0.337	0.726	R4GNG2_HUMAN Autocrine motility factor receptor (Fragment) OS=Homo sapiens OX=9606 GN=AMFR PE=1 SV=1
7	P90859	5.71e-41	159	564	0.194	0.222	HRDL1_CAEEL E3 ubiquitin-protein ligase hrd-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=hrdl-1 PE=1 SV=2
8	Q6NPT7	2.70e-40	155	460	0.148	0.207	HRD1B_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1B OS=Arabidopsis thaliana OX=3702 GN=HRD1B PE=2 SV=1
9	Q9LW77	1.11e-36	145	492	0.180	0.236	HRD1A_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1A OS=Arabidopsis thaliana OX=3702 GN=HRD1A PE=2 SV=1
10	Q20798	2.70e-31	131	610	0.126	0.133	HRD1_CAEEL E3 ubiquitin-protein ligase hrd-1 OS=Caenorhabditis elegans OX=6239 GN=sel-11 PE=3 SV=1
11	Q95SP2	1.17e-30	129	626	0.156	0.160	HRD1_DROME E3 ubiquitin-protein ligase HRD1 OS=Drosophila melanogaster OX=7227 GN=sip3 PE=1 SV=1
12	Q8VYC8	1.34e-30	129	578	0.156	0.173	RIN2_ARATH E3 ubiquitin protein ligase RIN2 OS=Arabidopsis thaliana OX=3702 GN=RIN2 PE=1 SV=1
13	Q9DBY1	6.32e-29	124	612	0.134	0.141	SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=Mus musculus OX=10090 GN=Syvn1 PE=1 SV=3
14	Q86TM6	8.22e-29	124	617	0.134	0.139	SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=Homo sapiens OX=9606 GN=SYVN1 PE=1 SV=2
15	Q8W4Q5	1.12e-26	117	577	0.149	0.166	RIN3_ARATH E3 ubiquitin protein ligase RIN3 OS=Arabidopsis thaliana OX=3702 GN=RIN3 PE=1 SV=2
16	F4KD92	1.38e-26	117	595	0.149	0.161	F4KD92_ARATH RPM1 interacting protein 3 OS=Arabidopsis thaliana OX=3702 GN=RIN3 PE=1 SV=1
17	O74757	1.44e-19	95.5	677	0.121	0.115	HRD1_SCHPO ERAD-associated E3 ubiquitin-protein ligase hrd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hrd1 PE=1 SV=1
18	Q4WCD2	2.31e-17	88.6	771	0.157	0.131	Q4WCD2_ASPFU RING finger protein OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_8G04840 PE=4 SV=1
19	Q8ILM8	4.22e-17	87.0	510	0.129	0.163	Q8ILM8_PLAF7 ERAD-associated E3 ubiquitin-protein ligase HRD1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1422500 PE=4 SV=2
20	Q38F27	2.56e-09	62.4	488	0.044	0.057	Q38F27_TRYB2 RING-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.3780 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02845 CUE	2e-06	38.7	CUE domain
2	PF18442 G2BR	2e-13	61.0	E3 gp78 Ube2g2-binding region (G2BR)
3	PF14447 Prok-RING_4	0.23	22.7	Prokaryotic RING finger family 4
4	PF12861 zf-ANAPC11	0.11	23.9	Anaphase-promoting complex subunit 11 RING-H2 finger
5	PF00097 zf-C3HC4	0.00019	32.5	Zinc finger, C3HC4 type (RING finger)
6	PF13923 zf-C3HC4_2	1.3e-06	39.4	Zinc finger, C3HC4 type (RING finger)
7	PF13920 zf-C3HC4_3	0.0014	29.8	Zinc finger, C3HC4 type (RING finger)
8	PF15227 zf-C3HC4_4	31	16.1	zinc finger of C3HC4-type, RING
9	PF12678 zf-rbx1	0.0078	27.8	RING-H2 zinc finger domain
10	PF17123 zf-RING_11	0.0019	29.2	RING-like zinc finger
11	PF17120 zf-RING_16	0.2	22.6	RING/Ubox like zinc-binding domain
12	PF13639 zf-RING_2	1.8e-08	45.9	Ring finger domain
13	PF14634 zf-RING_5	0.022	26.1	zinc-RING finger domain
14	PF13445 zf-RING_UBOX	0.00037	31.8	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000290649

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000338348	0.999	Ubiquitin-conjugating enzyme E2 G2
2	9606.ENSP00000351777	0.999	Transitional endoplasmic reticulum ATPase
3	9606.ENSP00000344741	0.998	Insulin-induced gene 1 protein
4	9606.ENSP00000441543	0.998	Polyubiquitin-C
5	9606.ENSP00000259512	0.996	Derlin-1
6	9606.ENSP00000261942	0.990	FAS-associated factor 2
7	9606.ENSP00000272317	0.990	Ubiquitin-40S ribosomal protein S27a
8	9606.ENSP00000405573	0.990	Glucose-6-phosphate isomerase
9	9606.ENSP00000158771	0.986	Derlin-2
10	9606.ENSP00000276461	0.983	Erlin-2
11	9606.ENSP00000304697	0.982	Polyubiquitin-B
12	9606.ENSP00000337053	0.980	Protein sel-1 homolog 1
13	9606.ENSP00000388107	0.979	Ubiquitin-60S ribosomal protein L40
14	9606.ENSP00000364235	0.963	E3 ubiquitin-protein ligase RNF5
15	9606.ENSP00000280700	0.954	Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase
16	9606.ENSP00000383911	0.953	Ubiquitin-associated domain-containing protein 2
17	9606.ENSP00000318165	0.950	Protein OS-9
18	9606.ENSP00000294119	0.938	UBX domain-containing protein 1
19	9606.ENSP00000366395	0.937	E3 ubiquitin-protein ligase synoviolin
20	9606.ENSP00000350708	0.936	UV excision repair protein RAD23 homolog B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	1.000	ubiquitin-protein transferase activity
GO:0061630	0.988	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0034976	0.995	response to endoplasmic reticulum stress
GO:0032446	0.995	protein modification by small protein conjugation
GO:0000209	0.992	protein polyubiquitination
GO:0065007	0.986	biological regulation
GO:0050794	0.984	regulation of cellular process
GO:0048583	0.976	regulation of response to stimulus
GO:0009966	0.971	regulation of signal transduction
GO:0048523	0.954	negative regulation of cellular process
GO:0044237	0.892	cellular metabolic process
GO:0009968	0.876	negative regulation of signal transduction
GO:0030111	0.866	regulation of Wnt signaling pathway
GO:0044260	0.688	cellular macromolecule metabolic process
GO:0060828	0.681	regulation of canonical Wnt signaling pathway
GO:0010498	0.675	proteasomal protein catabolic process
GO:0042221	0.669	response to chemical
GO:0030178	0.658	negative regulation of Wnt signaling pathway
GO:0010033	0.647	response to organic substance
GO:0006511	0.629	ubiquitin-dependent protein catabolic process
GO:0090090	0.622	negative regulation of canonical Wnt signaling pathway
GO:0043161	0.489	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:1901698	0.452	response to nitrogen compound
GO:0036503	0.400	ERAD pathway
GO:0080134	0.375	regulation of response to stress
GO:0030433	0.344	ubiquitin-dependent ERAD pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0032991	0.993	protein-containing complex
GO:0016020	0.990	membrane
GO:0031090	0.978	organelle membrane
GO:0005789	0.927	endoplasmic reticulum membrane
GO:0005829	0.525	cytosol
GO:0005634	0.357	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]