StarFunc result for job id Q9UKV8

User Input

>input (859 residues)
MYSGAGPALAPPAPPPPIQGYAFKPPPRPDFGTSGRTIKLQANFFEMDIPKIDIYHYELD
IKPEKCPRRVNREIVEHMVQHFKTQIFGDRKPVFDGRKNLYTAMPLPIGRDKVELEVTLP
GEGKDRIFKVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHLPSMRYTPVGRS
FFTASEGCSNPLGGGREVWFGFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFVCEVLDF
KSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQMKRKYRVCNVTRRPASHQTFPLQQES
GQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQ
TSTMIRATARSAPDRQEEISKLMRSASFNTDPYVREFGIMVKDEMTDVTGRVLQPPSILY
GGRNKAIATPVQGVWDMRNKQFHTGIEIKVWAIACFAPQRQCTEVHLKSFTEQLRKISRD
AGMPIQGQPCFCKYAQGADSVEPMFRHLKNTYAGLQLVVVILPGKTPVYAEVKRVGDTVL
GMATQCVQMKNVQRTTPQTLSNLCLKINVKLGGVNNILLPQGRPPVFQQPVIFLGADVTH
PPAGDGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQEIIQDLAAMVRELLIQFYKSTRFK
PTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKDYQPGITFIVVQKRHHTRLFCTDK
NERVGKSGNIPAGTTVDTKITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSSDELQ
ILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHTSGQSNGRDHQ
ALAKAVQVHQDTLRTMYFA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4krfA	0.939	0.987	0.000	817	0.785	0.825	4krfA.pdb.gz	The making of a slicer: activation of human argonaute-1.
2	PDB:4w5tA	0.921	0.979	0.000	807	0.936	0.996	4w5tA.pdb.gz	Gene regulation. Structural basis for microRNA targeting.
3	PDB:5vm9C	0.890	0.973	0.000	785	0.749	0.819	5vm9C.pdb.gz	Human Argonaute3 has slicer activity.
4	PDB:5weaA	0.860	0.965	0.000	764	0.881	0.991	5weaA.pdb.gz	Helix-7 in Argonaute2 shapes the microRNA seed region for rapid target recognition.
5	PDB:6oonA	0.905	0.990	0.000	785	0.726	0.795	6oonA.pdb.gz	Multidomain Convergence of Argonaute during RISC Assembly Correlates with the Formation of Internal Water Clusters.
6	AFDB:E7EXY4	0.983	0.967	0.000	873	0.919	0.904	E7EXY4.pdb.gz
7	AFDB:G5EES3	0.962	0.809	0.000	1023	0.689	0.579	G5EES3.pdb.gz	G5EES3_CAEEL Protein argonaute-2 OS=Caenorhabditis elegans OX=6239 GN=alg-1 PE=1 SV=1
8	AFDB:O16720	0.974	0.920	0.000	910	0.666	0.629	O16720.pdb.gz	O16720_CAEEL Protein argonaute-2 OS=Caenorhabditis elegans OX=6239 GN=alg-2 PE=1 SV=2
9	AFDB:Q32KD4	0.963	0.842	0.000	984	0.744	0.649	Q32KD4.pdb.gz	Q32KD4_DROME Argonaute-1, isoform A OS=Drosophila melanogaster OX=7227 GN=AGO1 PE=1 SV=1
10	AFDB:Q8CJF8	0.961	0.959	0.000	861	0.775	0.774	Q8CJF8.pdb.gz	AGO4_MOUSE Protein argonaute-4 OS=Mus musculus OX=10090 GN=Ago4 PE=2 SV=2
11	AFDB:Q8CJF9	0.958	0.957	0.000	860	0.802	0.801	Q8CJF9.pdb.gz	AGO3_MOUSE Protein argonaute-3 OS=Mus musculus OX=10090 GN=Ago3 PE=2 SV=2
12	AFDB:Q8CJG1	0.972	0.974	0.000	857	0.827	0.828	Q8CJG1.pdb.gz	AGO1_MOUSE Protein argonaute-1 OS=Mus musculus OX=10090 GN=Ago1 PE=1 SV=2
13	AFDB:D6RUV9	0.910	0.741	8.448E-102	1061	0.444	0.359	D6RUV9.pdb.gz	D6RUV9_TOBAC ARGONAUTE 1 OS=Nicotiana tabacum OX=4097 GN=AGO1 PE=1 SV=1
14	AFDB:O04379	0.901	0.744	1.355E-100	1048	0.437	0.358	O04379.pdb.gz	AGO1_ARATH Protein argonaute 1 OS=Arabidopsis thaliana OX=3702 GN=AGO1 PE=1 SV=1
15	AFDB:Q851R2	0.908	0.742	1.595E-100	1058	0.421	0.342	Q851R2.pdb.gz	MEL1_ORYSJ Protein argonaute MEL1 OS=Oryza sativa subsp. japonica OX=39947 GN=MEL1 PE=2 SV=1
16	PDB:7swfA	0.718	0.786	3.816E-79	778	0.405	0.447	7swfA.pdb.gz	The molecular mechanism of microRNA duplex selectivity of Arabidopsis ARGONAUTE10.
17	PDB:5guhA	0.682	0.763	1.217E-57	759	0.215	0.244	5guhA.pdb.gz	Crystal Structure of Silkworm PIWI-Clade Argonaute Siwi Bound to piRNA
18	PDB:6kr6A	0.607	0.717	3.632E-51	713	0.207	0.250	6kr6A.pdb.gz	Crystal structure of Drosophila Piwi.
19	PDB:7kpvD	0.445	0.438	8.934E-15	876	0.113	0.111	7kpvD.pdb.gz
20	PDB:1r6zZ	0.124	0.208	1.826E-5	499	0.048	0.082	1r6zZ.pdb.gz	The crystal structure of the Argonaute2 PAZ domain reveals an RNA binding motif in RNAi effector complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A6I8PTZ8	1496	891	0.822	0.792	A0A6I8PTZ8_HUMAN Argonaute RISC component 1 OS=Homo sapiens OX=9606 GN=AGO1 PE=1 SV=1
2	D6RUV9	675	1061	0.428	0.347	D6RUV9_TOBAC ARGONAUTE 1 OS=Nicotiana tabacum OX=4097 GN=AGO1 PE=1 SV=1
3	G5EES3	1238	1023	0.685	0.575	G5EES3_CAEEL Protein argonaute-2 OS=Caenorhabditis elegans OX=6239 GN=alg-1 PE=1 SV=1
4	G5EGR6	1237	1002	0.685	0.587	G5EGR6_CAEEL Protein argonaute-2 OS=Caenorhabditis elegans OX=6239 GN=alg-1 PE=1 SV=1
5	K4I874	1673	873	0.917	0.903	K4I874_DANRE Protein argonaute-2 OS=Danio rerio OX=7955 GN=AGO2 PE=1 SV=1
6	O04379	694	1048	0.438	0.359	AGO1_ARATH Protein argonaute 1 OS=Arabidopsis thaliana OX=3702 GN=AGO1 PE=1 SV=1
7	O16720	1194	910	0.667	0.630	O16720_CAEEL Protein argonaute-2 OS=Caenorhabditis elegans OX=6239 GN=alg-2 PE=1 SV=2
8	Q27IR0	1266	851	0.710	0.717	Q27IR0_DROME Argonaute-1 (Fragment) OS=Drosophila melanogaster OX=7227 GN=AGO1 PE=1 SV=1
9	Q32KD4	1327	984	0.744	0.649	Q32KD4_DROME Argonaute-1, isoform A OS=Drosophila melanogaster OX=7227 GN=AGO1 PE=1 SV=1
10	Q5TA58	1407	782	0.773	0.849	Q5TA58_HUMAN Argonaute RISC component 1 OS=Homo sapiens OX=9606 GN=AGO1 PE=1 SV=1
11	Q69VD5	688	979	0.427	0.375	PNH1_ORYSJ Protein argonaute PNH1 OS=Oryza sativa subsp. japonica OX=39947 GN=PHN1 PE=2 SV=1
12	Q7KY08	1327	950	0.744	0.673	Q7KY08_DROME Argonaute protein OS=Drosophila melanogaster OX=7227 GN=AGO1 PE=1 SV=1
13	Q851R2	655	1058	0.421	0.342	MEL1_ORYSJ Protein argonaute MEL1 OS=Oryza sativa subsp. japonica OX=39947 GN=MEL1 PE=2 SV=1
14	Q86B39	1194	891	0.667	0.643	Q86B39_CAEEL Protein argonaute-2 OS=Caenorhabditis elegans OX=6239 GN=alg-2 PE=1 SV=1
15	Q8CJF8	1402	861	0.778	0.776	AGO4_MOUSE Protein argonaute-4 OS=Mus musculus OX=10090 GN=Ago4 PE=2 SV=2
16	Q8CJF9	1439	860	0.801	0.800	AGO3_MOUSE Protein argonaute-3 OS=Mus musculus OX=10090 GN=Ago3 PE=2 SV=2
17	Q8CJG0	1778	860	0.993	0.992	AGO2_MOUSE Protein argonaute-2 OS=Mus musculus OX=10090 GN=Ago2 PE=1 SV=3
18	Q8CJG1	1498	857	0.822	0.824	AGO1_MOUSE Protein argonaute-1 OS=Mus musculus OX=10090 GN=Ago1 PE=1 SV=2
19	Q8T059	712	424	0.397	0.804	Q8T059_DROME LD26301p OS=Drosophila melanogaster OX=7227 GN=AGO1 PE=2 SV=1
20	Q960T1	954	601	0.534	0.764	Q960T1_DROME LD36719p OS=Drosophila melanogaster OX=7227 GN=AGO1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08699 ArgoL1	8.7e-18	75.0	Argonaute linker 1 domain
2	PF16488 ArgoL2	1.1e-09	49.7	Argonaute linker 2 domain
3	PF16487 ArgoMid	2e-29	113.0	Mid domain of argonaute
4	PF16486 ArgoN	3.7e-27	107.0	N-terminal domain of argonaute
5	PF02170 PAZ	1.6e-24	98.0	PAZ domain
6	PF02171 Piwi	5e-112	385.7	Piwi domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000220592

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000266987	0.999	RISC-loading complex subunit TARBP2
2	9606.ENSP00000379144	0.999	Trinucleotide repeat-containing gene 6A protein
3	9606.ENSP00000437256	0.999	Endoribonuclease Dicer
4	9606.ENSP00000335153	0.998	Heat shock protein HSP 90-alpha
5	9606.ENSP00000478754	0.998	Probable ATP-dependent RNA helicase DDX6
6	9606.ENSP00000356520	0.997	ATP-dependent RNA helicase A
7	9606.ENSP00000359506	0.997	Synaptic functional regulator FMR1
8	9606.ENSP00000350170	0.996	Fragile X mental retardation syndrome-related protein 1
9	9606.ENSP00000385269	0.996	ELAV-like protein 1
10	9606.ENSP00000336783	0.995	Trinucleotide repeat-containing gene 6C protein
11	9606.ENSP00000425561	0.992	Eukaryotic translation initiation factor 4E
12	9606.ENSP00000399797	0.990	Putative helicase MOV-10
13	9606.ENSP00000401946	0.990	Trinucleotide repeat-containing gene 6B protein
14	9606.ENSP00000425979	0.990	Ribonuclease 3
15	9606.ENSP00000265351	0.988	Exportin-5
16	9606.ENSP00000321706	0.988	Gem-associated protein 4
17	9606.ENSP00000275493	0.981	Epidermal growth factor receptor
18	9606.ENSP00000313007	0.976	Polyadenylate-binding protein 1
19	9606.ENSP00000362300	0.976	Protein argonaute-1
20	9606.ENSP00000269305	0.972	Cellular tumor antigen p53

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0035198	0.999	miRNA binding
GO:0003824	0.905	catalytic activity
GO:0140640	0.860	catalytic activity, acting on a nucleic acid
GO:0140098	0.832	catalytic activity, acting on RNA
GO:0004521	0.800	RNA endonuclease activity
GO:0003727	0.734	single-stranded RNA binding
GO:0016891	0.711	RNA endonuclease activity, producing 5'-phosphomonoesters
GO:0003725	0.667	double-stranded RNA binding
GO:0019899	0.585	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050789	0.996	regulation of biological process
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.994	primary metabolic process
GO:0048519	0.993	negative regulation of biological process
GO:0044237	0.993	cellular metabolic process
GO:0043170	0.989	macromolecule metabolic process
GO:0006807	0.988	nitrogen compound metabolic process
GO:0031323	0.986	regulation of cellular metabolic process
GO:0010468	0.985	regulation of gene expression
GO:0051171	0.980	regulation of nitrogen compound metabolic process
GO:0080090	0.977	regulation of primary metabolic process
GO:2000112	0.977	regulation of cellular macromolecule biosynthetic process
GO:0034641	0.968	cellular nitrogen compound metabolic process
GO:0070918	0.961	regulatory ncRNA processing
GO:0051246	0.947	regulation of protein metabolic process
GO:0031324	0.941	negative regulation of cellular metabolic process
GO:0009890	0.937	negative regulation of biosynthetic process
GO:0010558	0.931	negative regulation of macromolecule biosynthetic process
GO:0031327	0.931	negative regulation of cellular biosynthetic process
GO:0035196	0.929	miRNA processing
GO:0010608	0.927	post-transcriptional regulation of gene expression
GO:0051172	0.925	negative regulation of nitrogen compound metabolic process
GO:0034248	0.924	regulation of amide metabolic process
GO:0048522	0.910	positive regulation of cellular process
GO:0051248	0.883	negative regulation of protein metabolic process
GO:0006417	0.882	regulation of translation
GO:2000113	0.863	negative regulation of cellular macromolecule biosynthetic process
GO:0017148	0.827	negative regulation of translation
GO:0009893	0.817	positive regulation of metabolic process
GO:0016441	0.817	post-transcriptional gene silencing
GO:0035194	0.797	RNA-mediated post-transcriptional gene silencing
GO:0035195	0.741	miRNA-mediated gene silencing
GO:0071840	0.698	cellular component organization or biogenesis
GO:0010604	0.664	positive regulation of macromolecule metabolic process
GO:0051173	0.636	positive regulation of nitrogen compound metabolic process
GO:0016043	0.597	cellular component organization
GO:0019219	0.547	regulation of nucleobase-containing compound metabolic process
GO:0031325	0.542	positive regulation of cellular metabolic process
GO:0051252	0.514	regulation of RNA metabolic process
GO:0032501	0.439	multicellular organismal process
GO:0032502	0.412	developmental process
GO:0048856	0.340	anatomical structure development
GO:0051254	0.331	positive regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0005829	0.998	cytosol
GO:1990904	0.997	ribonucleoprotein complex
GO:0036464	0.992	cytoplasmic ribonucleoprotein granule
GO:0016442	0.978	RISC complex
GO:0031981	0.959	nuclear lumen
GO:0005654	0.946	nucleoplasm
GO:0016020	0.932	membrane
GO:1902494	0.922	catalytic complex
GO:0140535	0.884	intracellular protein-containing complex
GO:1905348	0.738	endonuclease complex
GO:1902555	0.731	endoribonuclease complex
GO:0000932	0.576	P-body
GO:0065010	0.422	extracellular membrane-bounded organelle
GO:0005615	0.384	extracellular space
GO:0031982	0.355	vesicle
GO:0012505	0.318	endomembrane system
GO:1903561	0.307	extracellular vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	0.800	Acting on ester bonds.
EC:3.1.26.-	0.711	Endoribonucleases producing 5'-phosphomonoesters.

[back to server]