StarFunc result for job id Q9UKW4

User Input

>input (847 residues)
MEPWKQCAQWLIHCKVLPTNHRVTWDSAQVFDLAQTLRDGVLLCQLLNNLRAHSINLKEI
NLRPQMSQFLCLKNIRTFLTACCETFGMRKSELFEAFDLFDVRDFGKVIETLSRLSRTPI
ALATGIRPFPTEESINDEDIYKGLPDLIDETLVEDEEDLYDCVYGEDEGGEVYEDLMKAE
EAHQPKCPENDIRSCCLAEIKQTEEKYTETLESIEKYFMAPLKRFLTAAEFDSVFINIPE
LVKLHRNLMQEIHDSIVNKNDQNLYQVFINYKERLVIYGQYCSGVESAISSLDYISKTKE
DVKLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTTDPTEKANLKLALDA
MKDLAQYVNEVKRDNETLREIKQFQLSIENLNQPVLLFGRPQGDGEIRITTLDKHTKQER
HIFLFDLAVIVCKRKGDNYEMKEIIDLQQYKIANNPTTDKENKKWSYGFYLIHTQGQNGL
EFYCKTKDLKKKWLEQFEMALSNIRPDYADSNFHDFKMHTFTRVTSCKVCQMLLRGTFYQ
GYLCFKCGARAHKECLGRVDNCGRVNSGEQGTLKLPEKRTNGLRRTPKQVDPGLPKMQVI
RNYSGTPPPALHEGPPLQLQAGDTVELLKGDAHSLFWQGRNLASGEVGFFPSDAVKPCPC
VPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIK
ILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPEHSAGQRGNRA
GNSLLSPKVLGIAIARYDFCARDMRELSLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPS
TYVEEDE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9R0C8	0.753	0.753	0.000	847	0.953	0.953	Q9R0C8.pdb.gz	VAV3_MOUSE Guanine nucleotide exchange factor VAV3 OS=Mus musculus OX=10090 GN=Vav3 PE=1 SV=2
2	AFDB:P15498	0.655	0.656	2.726E-92	845	0.587	0.588	P15498.pdb.gz	VAV_HUMAN Proto-oncogene vav OS=Homo sapiens OX=9606 GN=VAV1 PE=1 SV=4
3	AFDB:P52735	0.719	0.694	1.197E-90	878	0.547	0.527	P52735.pdb.gz	VAV2_HUMAN Guanine nucleotide exchange factor VAV2 OS=Homo sapiens OX=9606 GN=VAV2 PE=1 SV=2
4	AFDB:Q45FX5	0.633	0.539	1.070E-55	1007	0.313	0.263	Q45FX5.pdb.gz	VAV_CAEEL Protein vav-1 OS=Caenorhabditis elegans OX=6239 GN=vav-1 PE=1 SV=1
5	AFDB:Q9NHV9	0.578	0.615	1.767E-55	793	0.307	0.328	Q9NHV9.pdb.gz	VAV_DROME Protein vav OS=Drosophila melanogaster OX=7227 GN=Vav PE=1 SV=2
6	AFDB:Q9ES28	0.246	0.242	1.148E-20	862	0.187	0.183	Q9ES28.pdb.gz	ARHG7_MOUSE Rho guanine nucleotide exchange factor 7 OS=Mus musculus OX=10090 GN=Arhgef7 PE=1 SV=2
7	AFDB:Q63406	0.240	0.186	2.789E-19	1149	0.146	0.108	Q63406.pdb.gz	MCF2L_RAT Guanine nucleotide exchange factor DBS OS=Rattus norvegicus OX=10116 GN=Mcf2l PE=1 SV=3
8	AFDB:Q14155	0.239	0.250	3.198E-19	803	0.170	0.179	Q14155.pdb.gz	ARHG7_HUMAN Rho guanine nucleotide exchange factor 7 OS=Homo sapiens OX=9606 GN=ARHGEF7 PE=1 SV=2
9	AFDB:Q6PDM6	0.247	0.192	3.347E-19	1166	0.159	0.116	Q6PDM6.pdb.gz	Q6PDM6_MOUSE Mcf.2 transforming sequence-like OS=Mus musculus OX=10090 GN=Mcf2l PE=1 SV=1
10	AFDB:O15068	0.250	0.195	3.503E-19	1137	0.143	0.106	O15068.pdb.gz	MCF2L_HUMAN Guanine nucleotide exchange factor DBS OS=Homo sapiens OX=9606 GN=MCF2L PE=1 SV=2
11	PDB:4mt6A	0.269	0.505	2.994E-16	389	0.086	0.188	4mt6A.pdb.gz
12	PDB:7rx9A	0.205	0.394	5.532E-15	432	0.100	0.197	7rx9A.pdb.gz
13	PDB:1griA	0.104	0.390	2.166E-12	211	0.064	0.256	1griA.pdb.gz
14	PDB:4gouA	0.193	0.312	8.099E-10	507	0.067	0.112	4gouA.pdb.gz
15	PDB:2h8hA	0.138	0.232	8.661E-9	445	0.064	0.121	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
16	PDB:1k9aB	0.106	0.198	1.430E-8	441	0.050	0.095	1k9aB.pdb.gz
17	PDB:3qwyA	0.100	0.451	1.218E-7	170	0.044	0.218	3qwyA.pdb.gz
18	PDB:2lqnA	0.104	0.274	2.104E-7	303	0.064	0.178	2lqnA.pdb.gz
19	PDB:2eyzA	0.094	0.241	2.957E-6	304	0.059	0.164	2eyzA.pdb.gz
20	PDB:4fl2A	0.113	0.171	6.557E-5	555	0.040	0.061	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P15498	0.0	1006	845	0.588	0.589	VAV_HUMAN Proto-oncogene vav OS=Homo sapiens OX=9606 GN=VAV1 PE=1 SV=4
2	P27870	0.0	994	845	0.593	0.594	VAV_MOUSE Proto-oncogene vav OS=Mus musculus OX=10090 GN=Vav1 PE=1 SV=1
3	P52735	0.0	927	878	0.550	0.531	VAV2_HUMAN Guanine nucleotide exchange factor VAV2 OS=Homo sapiens OX=9606 GN=VAV2 PE=1 SV=2
4	P54100	0.0	992	843	0.591	0.594	VAV_RAT Proto-oncogene vav OS=Rattus norvegicus OX=10116 GN=Vav1 PE=2 SV=1
5	Q60992	0.0	946	868	0.555	0.541	VAV2_MOUSE Guanine nucleotide exchange factor VAV2 OS=Mus musculus OX=10090 GN=Vav2 PE=1 SV=1
6	Q96D37	0.0	914	790	0.528	0.566	Q96D37_HUMAN VAV1 protein OS=Homo sapiens OX=9606 GN=VAV1 PE=1 SV=2
7	Q9R0C8	0.0	1693	847	0.954	0.954	VAV3_MOUSE Guanine nucleotide exchange factor VAV3 OS=Mus musculus OX=10090 GN=Vav3 PE=1 SV=2
8	Q9UKW4	0.0	1769	847	1.000	1.000	VAV3_HUMAN Guanine nucleotide exchange factor VAV3 OS=Homo sapiens OX=9606 GN=VAV3 PE=1 SV=1
9	Q9NHV9	7.13e-99	327	793	0.231	0.247	VAV_DROME Protein vav OS=Drosophila melanogaster OX=7227 GN=Vav PE=1 SV=2
10	Q45FX5	1.87e-77	273	1007	0.249	0.210	VAV_CAEEL Protein vav-1 OS=Caenorhabditis elegans OX=6239 GN=vav-1 PE=1 SV=1
11	Q13588	6.32e-21	94.4	217	0.076	0.295	GRAP_HUMAN GRB2-related adapter protein OS=Homo sapiens OX=9606 GN=GRAP PE=1 SV=1
12	Q69ZK0	4.84e-19	95.5	1650	0.111	0.057	PREX1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Mus musculus OX=10090 GN=Prex1 PE=1 SV=2
13	Q8TCU6	6.05e-19	95.1	1659	0.110	0.056	PREX1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Homo sapiens OX=9606 GN=PREX1 PE=1 SV=3
14	A0A024RDM6	1.46e-18	92.8	652	0.097	0.126	A0A024RDM6_HUMAN SPATA13 (Fragment) OS=Homo sapiens OX=9606 GN=SPATA13 PE=4 SV=1
15	Q96N96	1.46e-18	92.8	652	0.097	0.126	SPT13_HUMAN Spermatogenesis-associated protein 13 OS=Homo sapiens OX=9606 GN=SPATA13 PE=1 SV=1
16	D3ZS72	1.79e-18	93.6	1635	0.106	0.055	D3ZS72_RAT Phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Prex1 PE=1 SV=4
17	A0A8I6GLR6	1.80e-18	93.6	1646	0.106	0.055	A0A8I6GLR6_RAT Phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Prex1 PE=4 SV=1
18	Q96PE2	2.55e-18	93.2	2063	0.097	0.040	ARHGH_HUMAN Rho guanine nucleotide exchange factor 17 OS=Homo sapiens OX=9606 GN=ARHGEF17 PE=1 SV=1
19	Q9NR80	5.67e-18	91.3	690	0.100	0.123	ARHG4_HUMAN Rho guanine nucleotide exchange factor 4 OS=Homo sapiens OX=9606 GN=ARHGEF4 PE=1 SV=3
20	Q5JYA6	6.46e-18	91.7	1385	0.086	0.053	Q5JYA6_HUMAN PLEKHG1 OS=Homo sapiens OX=9606 GN=PLEKHG1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	8.2e-06	36.9	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF03107 C1_2	3.3e+02	13.0	C1 domain
3	PF11971 CAMSAP_CH	1.9e-21	87.0	CAMSAP CH domain
4	PF06395 CDC24	0.2	23.3	CDC24 Calponin
5	PF00307 CH	2.3e-18	77.7	Calponin homology (CH) domain
6	PF10088 DUF2326	18	16.5	Uncharacterised protein conserved in bacteria (DUF2326)
7	PF00630 Filamin	3.7	19.8	Filamin/ABP280 repeat
8	PF18517 LZ3wCH	81	14.7	Leucine zipper with capping helix domain
9	PF00169 PH	5.4e-05	35.0	PH domain
10	PF15411 PH_10	54	15.5	Pleckstrin homology domain
11	PF15405 PH_5	1.6e+02	13.8	Pleckstrin homology domain
12	PF14446 Prok-RING_1	2.5e+02	13.0	Prokaryotic RING finger family 1
13	PF00621 RhoGEF	2.1e-36	137.4	RhoGEF domain
14	PF00017 SH2	4.1e-13	60.6	SH2 domain
15	PF00018 SH3_1	1.4e-14	64.8	SH3 domain
16	PF07653 SH3_2	9.9e-24	94.2	Variant SH3 domain
17	PF14604 SH3_9	1.8e-14	64.7	Variant SH3 domain
18	PF08746 zf-RING-like	9.2e+02	11.5	RING-like domain
19	PF17120 zf-RING_16	3.2e+02	12.4	RING/Ubox like zinc-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359073

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000046794	0.981	Lymphocyte cytosolic protein 2
2	9606.ENSP00000351209	0.979	Ephrin type-A receptor 2
3	9606.ENSP00000400175	0.978	Transforming protein RhoA
4	9606.ENSP00000383118	0.974	Cell division control protein 42 homolog
5	9606.ENSP00000348461	0.973	Ras-related C3 botulinum toxin substrate 1
6	9606.ENSP00000364907	0.972	Tyrosine-protein kinase SYK
7	9606.ENSP00000339467	0.971	Rho-related GTP-binding protein RhoG
8	9606.ENSP00000249071	0.967	Ras-related C3 botulinum toxin substrate 2
9	9606.ENSP00000275493	0.959	Epidermal growth factor receptor
10	9606.ENSP00000357392	0.940	Ephrin-A1
11	9606.ENSP00000422168	0.940	SH3 domain-binding protein 2
12	9606.ENSP00000286301	0.933	Macrophage colony-stimulating factor 1 receptor
13	9606.ENSP00000261023	0.931	Integrin alpha-V
14	9606.ENSP00000452786	0.929	Integrin beta-3
15	9606.ENSP00000264033	0.928	E3 ubiquitin-protein ligase CBL
16	9606.ENSP00000281821	0.928	Ephrin type-A receptor 4
17	9606.ENSP00000304283	0.927	Ras-related C3 botulinum toxin substrate 3
18	9606.ENSP00000263923	0.924	Vascular endothelial growth factor receptor 2
19	9606.ENSP00000376345	0.920	Growth factor receptor-bound protein 2
20	9606.ENSP00000391669	0.919	Breast cancer anti-estrogen resistance protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005085	0.999	guanyl-nucleotide exchange factor activity
GO:0005154	0.847	epidermal growth factor receptor binding
GO:0001784	0.447	phosphotyrosine residue binding
GO:0008047	0.312	enzyme activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048518	0.992	positive regulation of biological process
GO:0007166	0.988	cell surface receptor signaling pathway
GO:0050776	0.985	regulation of immune response
GO:0002376	0.984	immune system process
GO:0048522	0.983	positive regulation of cellular process
GO:0050817	0.972	coagulation
GO:0048584	0.969	positive regulation of response to stimulus
GO:0006909	0.965	phagocytosis
GO:0035556	0.965	intracellular signal transduction
GO:0002768	0.963	immune response-regulating cell surface receptor signaling pathway
GO:0001775	0.962	cell activation
GO:0042060	0.954	wound healing
GO:0002684	0.951	positive regulation of immune system process
GO:0007599	0.946	hemostasis
GO:0065009	0.940	regulation of molecular function
GO:0023051	0.940	regulation of signaling
GO:0010646	0.934	regulation of cell communication
GO:0051249	0.928	regulation of lymphocyte activation
GO:0002696	0.927	positive regulation of leukocyte activation
GO:0050790	0.926	regulation of catalytic activity
GO:0009966	0.922	regulation of signal transduction
GO:0050778	0.914	positive regulation of immune response
GO:0051336	0.905	regulation of hydrolase activity
GO:0051251	0.900	positive regulation of lymphocyte activation
GO:0002757	0.889	immune response-activating signaling pathway
GO:0042221	0.883	response to chemical
GO:0016043	0.881	cellular component organization
GO:1902531	0.872	regulation of intracellular signal transduction
GO:0002429	0.871	immune response-activating cell surface receptor signaling pathway
GO:0070663	0.862	regulation of leukocyte proliferation
GO:0007169	0.855	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0007264	0.852	small GTPase mediated signal transduction
GO:0042330	0.849	taxis
GO:0030155	0.834	regulation of cell adhesion
GO:0019222	0.832	regulation of metabolic process
GO:0051056	0.819	regulation of small GTPase mediated signal transduction
GO:0007596	0.814	blood coagulation
GO:0050670	0.806	regulation of lymphocyte proliferation
GO:0006935	0.805	chemotaxis
GO:0031323	0.802	regulation of cellular metabolic process
GO:0043085	0.790	positive regulation of catalytic activity
GO:0016477	0.782	cell migration
GO:0002252	0.779	immune effector process
GO:0043087	0.756	regulation of GTPase activity
GO:0070887	0.737	cellular response to chemical stimulus
GO:0030168	0.700	platelet activation
GO:0032502	0.646	developmental process
GO:0043549	0.621	regulation of kinase activity
GO:0048856	0.617	anatomical structure development
GO:0009893	0.609	positive regulation of metabolic process
GO:0060326	0.601	cell chemotaxis
GO:0031325	0.471	positive regulation of cellular metabolic process
GO:0080090	0.467	regulation of primary metabolic process
GO:0008152	0.447	metabolic process
GO:0042327	0.440	positive regulation of phosphorylation
GO:0090066	0.423	regulation of anatomical structure size
GO:0032535	0.410	regulation of cellular component size
GO:0045785	0.404	positive regulation of cell adhesion
GO:0060255	0.403	regulation of macromolecule metabolic process
GO:0044237	0.368	cellular metabolic process
GO:0120036	0.362	plasma membrane bounded cell projection organization
GO:0010604	0.356	positive regulation of macromolecule metabolic process
GO:0050851	0.353	antigen receptor-mediated signaling pathway
GO:0050900	0.348	leukocyte migration
GO:0008284	0.340	positive regulation of cell population proliferation
GO:0033674	0.340	positive regulation of kinase activity
GO:0051171	0.323	regulation of nitrogen compound metabolic process
GO:0051173	0.309	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0005829	0.996	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]