StarFunc result for job id Q9UKW6

User Input

>input (265 residues)
MPSLPHSHRVMLDSVTHSTFLPNASFCDPLMSWTDLFSNEEYYPAFEHQTACDSYWTSVH
PEYWTKRHVWEWLQFCCDQYKLDTNCISFCNFNISGLQLCSMTQEEFVEAAGLCGEYLYF
ILQNIRTQGYSFFNDAEESKATIKDYADSNCLKTSGIKSQDCHSHSRTSLQSSHLWEFVR
DLLLSPEENCGILEWEDREQGIFRVVKSEALAKMWGQRKKNDRMTYEKLSRALRYYYKTG
ILERVDRRLVYKFGKNAHGWQEDKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UKW6	1.000	1.000	2.086E-45	265	1.000	1.000	Q9UKW6.pdb.gz	ELF5_HUMAN ETS-related transcription factor Elf-5 OS=Homo sapiens OX=9606 GN=ELF5 PE=1 SV=2
2	AFDB:Q9NZC4	0.350	0.310	5.416E-21	300	0.430	0.380	Q9NZC4.pdb.gz	EHF_HUMAN ETS homologous factor OS=Homo sapiens OX=9606 GN=EHF PE=2 SV=1
3	AFDB:A0A024R974	0.344	0.247	6.287E-16	371	0.351	0.251	A0A024R974.pdb.gz
4	AFDB:Q3UPW2	0.350	0.238	1.389E-15	391	0.374	0.253	Q3UPW2.pdb.gz	ELF3_MOUSE ETS-related transcription factor Elf-3 OS=Mus musculus OX=10090 GN=Elf3 PE=1 SV=1
5	AFDB:Q9WTP3	0.329	0.272	2.024E-13	325	0.287	0.234	Q9WTP3.pdb.gz	SPDEF_MOUSE SAM pointed domain-containing Ets transcription factor OS=Mus musculus OX=10090 GN=Spdef PE=2 SV=1
6	AFDB:O95238	0.307	0.245	1.311E-12	335	0.268	0.212	O95238.pdb.gz	SPDEF_HUMAN SAM pointed domain-containing Ets transcription factor OS=Homo sapiens OX=9606 GN=SPDEF PE=1 SV=1
7	AFDB:Q9Y603	0.292	0.228	2.586E-12	341	0.264	0.205	Q9Y603.pdb.gz	ETV7_HUMAN Transcription factor ETV7 OS=Homo sapiens OX=9606 GN=ETV7 PE=1 SV=1
8	AFDB:A0A024R3M5	0.295	0.176	1.583E-11	452	0.264	0.155	A0A024R3M5.pdb.gz
9	AFDB:Q04688	0.309	0.193	4.144E-11	464	0.249	0.142	Q04688.pdb.gz	ELG_DROME DNA-binding protein Ets97D OS=Drosophila melanogaster OX=7227 GN=Ets97D PE=1 SV=2
10	AFDB:A2RV31	0.290	0.198	4.385E-11	391	0.272	0.184	A2RV31.pdb.gz	A2RV31_DANRE Transcription factor ETV7 OS=Danio rerio OX=7955 GN=zgc:158758 PE=2 SV=1
11	PDB:2qb0B	0.249	0.273	1.076E-2	241	0.079	0.087	2qb0B.pdb.gz	Polymer-driven crystallization.
12	PDB:7ff0A	0.201	0.249	5.347E-1	206	0.053	0.068	7ff0A.pdb.gz	Inhibitory mechanism of gold analogues against Pseudomonas global virulence factor regulator Vfr
13	PDB:3cuqC	0.175	0.254	8.410E-1	173	0.038	0.058	3cuqC.pdb.gz
14	PDB:4mtdD	0.146	0.242	8.410E-1	151	0.026	0.046	4mtdD.pdb.gz	Structural and Mechanistic Basis of Zinc Regulation Across the E. coli Zur Regulon.
15	PDB:5i2dG	0.193	0.249	8.410E-1	195	0.053	0.072	5i2dG.pdb.gz	Structural basis of transcription activation.
16	PDB:4byyA	0.191	0.217	8.899E-1	226	0.064	0.075	4byyA.pdb.gz
17	PDB:3i54D	0.170	0.189	9.966E-1	228	0.053	0.061	3i54D.pdb.gz	Structural Insights into the Mechanism of the Allosteric Transitions of Mycobacterium tuberculosis cAMP Receptor Protein.
18	PDB:3iwzD	0.205	0.252	1.323	208	0.057	0.072	3iwzD.pdb.gz
19	PDB:3i58A	0.132	0.108	1.400	328	0.034	0.027	3i58A.pdb.gz	Molecular basis of substrate promiscuity for the SAM-dependent O-methyltransferase NcsB1, involved in the biosynthesis of the enediyne antitumor antibiotic neocarzinostatin.
20	PDB:1tw2B	0.121	0.098	1.481	350	0.068	0.051	1tw2B.pdb.gz	Crystal structure of a ternary complex of DnrK, a methyltransferase in daunorubicin biosynthesis, with bound products

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8VDK3	0.0	508	253	0.909	0.953	ELF5_MOUSE ETS-related transcription factor Elf-5 OS=Mus musculus OX=10090 GN=Elf5 PE=2 SV=2
2	Q9UKW6	0.0	560	265	1.000	1.000	ELF5_HUMAN ETS-related transcription factor Elf-5 OS=Homo sapiens OX=9606 GN=ELF5 PE=1 SV=2
3	Q9NZC4	2.90e-65	207	300	0.442	0.390	EHF_HUMAN ETS homologous factor OS=Homo sapiens OX=9606 GN=EHF PE=2 SV=1
4	Q3UPW2	1.01e-38	141	391	0.230	0.156	ELF3_MOUSE ETS-related transcription factor Elf-3 OS=Mus musculus OX=10090 GN=Elf3 PE=1 SV=1
5	P78545	1.16e-38	140	371	0.230	0.164	ELF3_HUMAN ETS-related transcription factor Elf-3 OS=Homo sapiens OX=9606 GN=ELF3 PE=1 SV=1
6	Q9WTP3	1.09e-29	115	325	0.268	0.218	SPDEF_MOUSE SAM pointed domain-containing Ets transcription factor OS=Mus musculus OX=10090 GN=Spdef PE=2 SV=1
7	O95238	1.60e-29	115	335	0.260	0.206	SPDEF_HUMAN SAM pointed domain-containing Ets transcription factor OS=Homo sapiens OX=9606 GN=SPDEF PE=1 SV=1
8	E9PPS9	4.82e-21	87.8	126	0.170	0.357	E9PPS9_HUMAN ETS homologous factor OS=Homo sapiens OX=9606 GN=EHF PE=1 SV=1
9	A8WFJ9	1.45e-20	92.4	437	0.162	0.098	ETS4_CAEEL Transcription factor ets-4 OS=Caenorhabditis elegans OX=6239 GN=ets-4 PE=1 SV=1
10	E9PN75	2.70e-20	87.0	166	0.166	0.265	E9PN75_HUMAN ETS homologous factor (Fragment) OS=Homo sapiens OX=9606 GN=EHF PE=1 SV=1
11	E9PQX0	3.27e-20	86.7	158	0.166	0.278	E9PQX0_HUMAN ETS homologous factor (Fragment) OS=Homo sapiens OX=9606 GN=EHF PE=1 SV=1
12	E9PQR6	5.48e-20	86.3	173	0.166	0.254	E9PQR6_HUMAN ETS homologous factor (Fragment) OS=Homo sapiens OX=9606 GN=EHF PE=1 SV=1
13	P20105	5.67e-19	88.6	829	0.143	0.046	E74EA_DROME Ecdysone-induced protein 74EF isoform A OS=Drosophila melanogaster OX=7227 GN=Eip74EF PE=2 SV=2
14	H2KYY1	2.32e-18	85.9	420	0.158	0.100	H2KYY1_CAEEL ETS domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=elf-1 PE=3 SV=1
15	P11536	2.71e-18	86.7	883	0.143	0.043	E74EB_DROME Ecdysone-induced protein 74EF isoform B OS=Drosophila melanogaster OX=7227 GN=Eip74EF PE=2 SV=2
16	Q400M2	3.56e-18	85.5	419	0.158	0.100	Q400M2_CAEEL ETS domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=elf-1 PE=3 SV=2
17	Q15723	5.05e-18	85.5	593	0.185	0.083	ELF2_HUMAN ETS-related transcription factor Elf-2 OS=Homo sapiens OX=9606 GN=ELF2 PE=1 SV=2
18	B7Z720	5.62e-18	85.1	521	0.147	0.075	B7Z720_HUMAN E74-like factor 2 (Ets domain transcription factor), isoform CRA_b OS=Homo sapiens OX=9606 GN=ELF2 PE=2 SV=1
19	Q9JHC9	6.52e-18	85.1	593	0.147	0.066	ELF2_MOUSE ETS-related transcription factor Elf-2 OS=Mus musculus OX=10090 GN=Elf2 PE=1 SV=1
20	Q01543	1.46e-17	84.0	452	0.242	0.142	FLI1_HUMAN Friend leukemia integration 1 transcription factor OS=Homo sapiens OX=9606 GN=FLI1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00178 Ets	1.8e-27	106.8	Ets-domain
2	PF02198 SAM_PNT	2.8e-26	102.6	Sterile alpha motif (SAM)/Pointed domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000311010

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361875	0.817	WAP four-disulfide core domain protein 5
2	9606.ENSP00000388620	0.703	Eomesodermin homolog
3	9606.ENSP00000370408	0.699	Homeobox protein CDX-2
4	9606.ENSP00000368632	0.698	Trans-acting T-cell-specific transcription factor GATA-3
5	9606.ENSP00000352926	0.655	Transcriptional enhancer factor TEF-3
6	9606.ENSP00000201031	0.654	Transcription factor AP-2 gamma
7	9606.ENSP00000250448	0.647	Hepatocyte nuclear factor 3-alpha
8	9606.ENSP00000259803	0.589	Chorion-specific transcription factor GCMa
9	9606.ENSP00000373487	0.571	Keratin, type I cytoskeletal 18
10	9606.ENSP00000422488	0.555	Steroid hormone receptor ERR2
11	9606.ENSP00000341030	0.543	Beta-casein
12	9606.ENSP00000482954	0.517	Prolactin receptor
13	9606.ENSP00000259915	0.516	POU domain, class 5, transcription factor 1
14	9606.ENSP00000341208	0.516	Signal transducer and activator of transcription 5A
15	9606.ENSP00000332293	0.511	Achaete-scute homolog 2
16	9606.ENSP00000302150	0.510	Prolactin
17	9606.ENSP00000452786	0.503	Integrin beta-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0003700	0.974	DNA-binding transcription factor activity
GO:0000976	0.946	transcription cis-regulatory region binding
GO:0000981	0.944	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.930	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001228	0.827	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	0.742	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048856	0.995	anatomical structure development
GO:0009987	0.993	cellular process
GO:0006355	0.993	regulation of DNA-templated transcription
GO:0048518	0.988	positive regulation of biological process
GO:0032501	0.980	multicellular organismal process
GO:0048522	0.974	positive regulation of cellular process
GO:0007275	0.950	multicellular organism development
GO:0009893	0.940	positive regulation of metabolic process
GO:0048869	0.934	cellular developmental process
GO:0009653	0.933	anatomical structure morphogenesis
GO:0010604	0.932	positive regulation of macromolecule metabolic process
GO:0051173	0.927	positive regulation of nitrogen compound metabolic process
GO:0031325	0.927	positive regulation of cellular metabolic process
GO:0006357	0.926	regulation of transcription by RNA polymerase II
GO:0030154	0.907	cell differentiation
GO:0045935	0.880	positive regulation of nucleobase-containing compound metabolic process
GO:0009888	0.877	tissue development
GO:0031328	0.877	positive regulation of cellular biosynthetic process
GO:0010557	0.875	positive regulation of macromolecule biosynthetic process
GO:0048519	0.860	negative regulation of biological process
GO:0045893	0.855	positive regulation of DNA-templated transcription
GO:0048513	0.812	animal organ development
GO:0048523	0.759	negative regulation of cellular process
GO:0009790	0.716	embryo development
GO:0045944	0.675	positive regulation of transcription by RNA polymerase II
GO:0048646	0.606	anatomical structure formation involved in morphogenesis
GO:0060429	0.495	epithelium development
GO:0050793	0.444	regulation of developmental process
GO:0048731	0.336	system development
GO:0045595	0.310	regulation of cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0031981	0.975	nuclear lumen
GO:0005654	0.955	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]