StarFunc result for job id Q9UKX2

User Input

>input (1941 residues)
MSSDSELAVFGEAAPFLRKSERERIEAQNRPFDAKTSVFVAEPKESFVKGTIQSREGGKV
TVKTEGGATLTVKDDQVFPMNPPKYDKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSG
LFCVTVNPYKWLPVYKPEVVTAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGE
SGAGKTVNTKRVIQYFATIAVTGEKKKEEITSGKIQGTLEDQIISANPLLEAFGNAKTVR
NDNSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVVFQLKAERSYHIFYQITSNKKPEL
IEMLLITTNPYDYPFVSQGEISVASIDDQEELMATDSAIDILGFTNEEKVSIYKLTGAVM
HYGNLKFKQKQREEQAEPDGTEVADKAAYLQSLNSADLLKALCYPRVKVGNEYVTKGQTV
EQVSNAVGALAKAVYEKMFLWMVARINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLC
INFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLAACIELIEKPMGIFSILEEE
CMFPKATDTSFKNKLYDQHLGKSANFQKPKVVKGKAEAHFALIHYAGVVDYNITGWLEKN
KDPLNETVVGLYQKSAMKTLAQLFSGAQTAEGEGAGGGAKKGGKKKGSSFQTVSALFREN
LNKLMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRIL
YADFKQRYKVLNASAIPEGQFIDSKKASEKLLASIDIDHTQYKFGHTKVFFKAGLLGLLE
EMRDDKLAQLITRTQARCRGFLARVEYQRMVERREAIFCIQYNIRSFMNVKHWPWMKLFF
KIKPLLKSAETEKEMATMKEEFQKIKDELAKSEAKRKELEEKMVTLLKEKNDLQLQVQAE
AEGLADAEERCDQLIKTKIQLEAKIKEVTERAEDEEEINAELTAKKRKLEDECSELKKDI
DDLELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLTKEKKALQEAHQQTLDDLQAEE
DKVNTLTKAKIKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLAQESIMDIENEKQ
QLDEKLKKKEFEISNLQSKIEDEQALGIQLQKKIKELQARIEELEEEIEAERASRAKAEK
QRSDLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKMRRDLEEATLQHEATAATLRK
KHADSVAELGEQIDNLQRVKQKLEKEKSEMKMEIDDLASNVETVSKAKGNLEKMCRTLED
QLSELKSKEEEQQRLINDLTAQRGRLQTESGEFSRQLDEKEALVSQLSRGKQAFTQQIEE
LKRQLEEEIKAKNALAHALQSSRHDCDLLREQYEEEQESKAELQRALSKANTEVAQWRTK
YETDAIQRTEELEEAKKKLAQRLQAAEEHVEAVNAKCASLEKTKQRLQNEVEDLMLDVER
TNAACAALDKKQRNFDKILAEWKQKCEETHAELEASQKEARSLGTELFKIKNAYEESLDQ
LETLKRENKNLQQEISDLTEQIAEGGKRIHELEKIKKQVEQEKCELQAALEEAEASLEHE
EGKILRIQLELNQVKSEVDRKIAEKDEEIDQLKRNHIRIVESMQSTLDAEIRSRNDAIRL
KKKMEGDLNEMEIQLNHANRMAAEALRNYRNTQGILKDTQIHLDDALRSQEDLKEQLAMV
ERRANLLQAEIEELRATLEQTERSRKIAEQELLDASERVQLLHTQNTSLINTKKKLETDI
SQMQGEMEDILQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQ
LRLDEAEQLALKGGKKQIQKLEARVRELEGEVESEQKRNAEAVKGLRKHERRVKELTYQT
EEDRKNILRLQDLVDKLQAKVKSYKRQAEEAEEQSNTNLAKFRKLQHELEEAEERADIAE
SQVNKLRVKSREVHTKVISEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4pa0A	0.341	0.660	0.000	974	0.320	0.638	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
2	AFDB:A0A0G2JY53	0.626	0.634	0.000	1915	0.548	0.556	A0A0G2JY53.pdb.gz	A0A0G2JY53_RAT Myosin, heavy chain 15 OS=Rattus norvegicus OX=10116 GN=Myh15 PE=3 SV=2
3	AFDB:A0A0N4STT5	0.660	0.639	0.000	2008	0.782	0.755	A0A0N4STT5.pdb.gz
4	AFDB:A7E2Y1	0.681	0.667	0.000	1983	0.674	0.660	A7E2Y1.pdb.gz	MYH7B_HUMAN Myosin-7B OS=Homo sapiens OX=9606 GN=MYH7B PE=1 SV=4
5	AFDB:B1AR69	0.654	0.655	0.000	1938	0.818	0.819	B1AR69.pdb.gz	B1AR69_MOUSE Myosin, heavy polypeptide 13, skeletal muscle OS=Mus musculus OX=10090 GN=Myh13 PE=1 SV=1
6	AFDB:B3DFS9	0.645	0.635	0.000	1974	0.400	0.393	B3DFS9.pdb.gz
7	AFDB:B8A568	0.694	0.696	0.000	1937	0.811	0.813	B8A568.pdb.gz	B8A568_DANRE Myosin, heavy polypeptide 1.1, skeletal muscle OS=Danio rerio OX=7955 GN=cb20 PE=1 SV=1
8	AFDB:B8JLS3	0.681	0.683	0.000	1936	0.761	0.763	B8JLS3.pdb.gz
9	AFDB:E7FD18	0.645	0.644	0.000	1945	0.719	0.717	E7FD18.pdb.gz
10	AFDB:F1QC64	0.638	0.704	0.000	1749	0.354	0.393	F1QC64.pdb.gz
11	AFDB:F1R3G4	0.631	0.616	0.000	1992	0.393	0.383	F1R3G4.pdb.gz	F1R3G4_DANRE Myosin, heavy chain 10, non-muscle OS=Danio rerio OX=7955 GN=myh10 PE=1 SV=1
12	PDB:4pa0B	0.341	0.701	1.034E-103	920	0.312	0.659	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
13	PDB:4p7hB	0.340	0.677	1.467E-99	952	0.309	0.630	4p7hB.pdb.gz
14	PDB:5tbyA	0.366	0.708	3.883E-96	954	0.393	0.799	5tbyA.pdb.gz
15	PDB:7mf3B	0.364	0.766	1.335E-67	896	0.225	0.488	7mf3B.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
16	PDB:4anjA	0.343	0.657	9.579E-63	995	0.143	0.278	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
17	PDB:6ycxB	0.364	0.823	7.777E-56	817	0.120	0.285	6ycxB.pdb.gz	Full-length Plasmodium falciparum myosin A and essential light chain PfELC structures provide new anti-malarial targets.
18	PDB:6fyxo	0.047	0.102	2.715E-2	529	0.038	0.140	6fyxo.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
19	PDB:7wrgA	0.060	0.125	1.190E-1	812	0.038	0.090	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
20	PDB:4w8fB	0.040	0.033	2.046E-1	2609	0.038	0.028	4w8fB.pdb.gz	Allosteric communication in the Dynein motor domain.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JY53	2112	1922	0.564	0.569	A0A0G2JY53_RAT Myosin, heavy chain 15 OS=Rattus norvegicus OX=10116 GN=Myh15 PE=3 SV=2
2	A0A0G2K0F5	3795	1912	0.958	0.973	A0A0G2K0F5_RAT Myosin heavy chain 2 OS=Rattus norvegicus OX=10116 GN=Myh2 PE=1 SV=2
3	A0A0G2K1V4	3665	1937	0.928	0.930	A0A0G2K1V4_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=2
4	A0A0G2K484	3642	1939	0.924	0.925	A0A0G2K484_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=2
5	A0A0R4INI3	3090	1938	0.786	0.787	A0A0R4INI3_DANRE Slow myosin heavy chain 1 OS=Danio rerio OX=7955 GN=fb18g10 PE=1 SV=1
6	A0A1D8PN92	694	1948	0.217	0.216	A0A1D8PN92_CANAL Myosin 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MYO1 PE=3 SV=1
7	A2AQP0	2547	1941	0.677	0.677	MYH7B_MOUSE Myosin-7B OS=Mus musculus OX=10090 GN=Myh7b PE=3 SV=1
8	A6QLN6	1278	1972	0.399	0.393	A6QLN6_BOVIN MYH11 protein OS=Bos taurus OX=9913 GN=MYH11 PE=1 SV=1
9	A7E2Y1	2549	1983	0.675	0.661	MYH7B_HUMAN Myosin-7B OS=Homo sapiens OX=9606 GN=MYH7B PE=1 SV=4
10	B1AR69	3223	1938	0.818	0.819	B1AR69_MOUSE Myosin, heavy polypeptide 13, skeletal muscle OS=Mus musculus OX=10090 GN=Myh13 PE=1 SV=1
11	B6IDE1	3108	1939	0.783	0.783	B6IDE1_DANRE Slow myosin heavy chain 2 OS=Danio rerio OX=7955 GN=MYH7 PE=1 SV=1
12	B6RK61	2572	1941	0.676	0.676	B6RK61_RAT Myosin heavy chain 7B OS=Rattus norvegicus OX=10116 GN=Myh7b PE=2 SV=1
13	B8A568	3167	1937	0.812	0.814	B8A568_DANRE Myosin, heavy polypeptide 1.1, skeletal muscle OS=Danio rerio OX=7955 GN=cb20 PE=1 SV=1
14	F1LMU0	3625	1939	0.919	0.920	F1LMU0_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh4 PE=1 SV=1
15	F1LRV9	3670	1943	0.935	0.934	F1LRV9_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=3
16	F1QZW1	3105	1938	0.789	0.790	F1QZW1_DANRE Myosin heavy chain 7 OS=Danio rerio OX=7955 GN=mg:cb02g011 PE=1 SV=1
17	F1R3G4	1245	1992	0.395	0.385	F1R3G4_DANRE Myosin, heavy chain 10, non-muscle OS=Danio rerio OX=7955 GN=myh10 PE=1 SV=1
18	F7F0L5	2512	1929	0.661	0.665	F7F0L5_RAT Myosin heavy chain 7B OS=Rattus norvegicus OX=10116 GN=Myh7b PE=3 SV=1
19	G3UW82	3848	1942	0.968	0.967	G3UW82_MOUSE Myosin, heavy polypeptide 2, skeletal muscle, adult OS=Mus musculus OX=10090 GN=Myh2 PE=1 SV=1
20	G3V6E1	3858	1942	0.971	0.970	G3V6E1_RAT Myosin heavy chain 2 OS=Rattus norvegicus OX=10116 GN=Myh2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13401 AAA_22	3.6e+02	12.8	AAA domain
2	PF19220 Crescentin	4.5	17.9	Crescentin protein
3	PF00612 IQ	12	17.0	IQ calmodulin-binding motif
4	PF00063 Myosin_head	2.6e-283	953.0	Myosin head (motor domain)
5	PF02736 Myosin_N	2e-12	57.9	Myosin N-terminal SH3-like domain
6	PF01576 Myosin_tail_1	4.1e-161	549.9	Myosin tail

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000245503

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307280	0.964	Myosin light chain 1/3, skeletal muscle isoform
2	9606.ENSP00000226207	0.958	Myosin-1
3	9606.ENSP00000325239	0.956	Myosin light chain, phosphorylatable, fast skeletal muscle
4	9606.ENSP00000383023	0.944	Myosin light chain 5
5	9606.ENSP00000450385	0.942	Myosin light chain 6B
6	9606.ENSP00000379210	0.940	Myosin light chain 3
7	9606.ENSP00000279022	0.936	Myosin regulatory light polypeptide 9
8	9606.ENSP00000400175	0.936	Transforming protein RhoA
9	9606.ENSP00000382177	0.932	Unconventional myosin-Va
10	9606.ENSP00000384330	0.929	Myosin-8
11	9606.ENSP00000353590	0.926	Myosin-10
12	9606.ENSP00000379350	0.924	Integrin beta-1
13	9606.ENSP00000346839	0.922	Fibronectin type III domain containing
14	9606.ENSP00000347507	0.917	Myosin-7
15	9606.ENSP00000471457	0.917	Unconventional myosin-IXb
16	9606.ENSP00000386041	0.912	Myosin-6
17	9606.ENSP00000354782	0.906	T-cell surface glycoprotein CD3 zeta chain
18	9606.ENSP00000404570	0.906	Myosin-13
19	9606.ENSP00000216181	0.905	Myosin-9
20	9606.ENSP00000431445	0.903	T-cell surface glycoprotein CD3 gamma chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0000146	0.999	microfilament motor activity
GO:0008092	0.935	cytoskeletal protein binding
GO:0003779	0.907	actin binding
GO:0044877	0.851	protein-containing complex binding
GO:0097159	0.475	organic cyclic compound binding
GO:1901363	0.474	heterocyclic compound binding
GO:0051015	0.467	actin filament binding
GO:0003824	0.448	catalytic activity
GO:0016787	0.433	hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0032501	0.987	multicellular organismal process
GO:0003012	0.982	muscle system process
GO:0006936	0.943	muscle contraction
GO:0030029	0.931	actin filament-based process
GO:0006941	0.927	striated muscle contraction
GO:0071840	0.917	cellular component organization or biogenesis
GO:0016043	0.912	cellular component organization
GO:0050896	0.810	response to stimulus
GO:0065007	0.803	biological regulation
GO:0097435	0.799	supramolecular fiber organization
GO:0030036	0.786	actin cytoskeleton organization
GO:0032502	0.751	developmental process
GO:0050789	0.749	regulation of biological process
GO:0031034	0.741	myosin filament assembly
GO:0048856	0.700	anatomical structure development
GO:0061061	0.352	muscle structure development
GO:0050794	0.349	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0015629	0.999	actin cytoskeleton
GO:0043292	0.999	contractile fiber
GO:0016459	0.976	myosin complex
GO:0005829	0.919	cytosol
GO:0005859	0.853	muscle myosin complex
GO:0043227	0.714	membrane-bounded organelle
GO:0030016	0.632	myofibril
GO:0043231	0.543	intracellular membrane-bounded organelle
GO:0030017	0.422	sarcomere

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.8	0.999	myosin ATPase.
EC:3.-.-.-	0.433	Hydrolases.

[back to server]