StarFunc result for job id Q9UKX3

User Input

>input (1938 residues)
MSSDAEMAIFGEAAPYLRKPEKERIEAQNRPFDSKKACFVADNKEMYVKGMIQTRENDKV
IVKTLDDRMLTLNNDQVFPMNPPKFDKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSG
LFCVTVNPYKWLPVYKPEVVAAYRGKKRQEAPPHIFSISDNAYQFMLTDRDNQSILITGE
SGAGKTVNTKRVIQYFATIAVTGDKKKETQPGKMQGTLEDQIIQANPLLEAFGNAKTVRN
DNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVTFQLSSERSYHIFYQIMSNKKPELI
DLLLISTNPFDFPFVSQGEVTVASIDDSEELLATDNAIDILGFSSEEKVGIYKLTGAVMH
YGNMKFKQKQREEQAEPDGTEVADKAGYLMGLNSAEMLKGLCCPRVKVGNEYVTKGQNVQ
QVTNSVGALAKAVYEKMFLWMVTRINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLCI
NFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLAACIELIEKPMGIFSILEEEC
MFPKATDTSFKNKLYDQHLGKSNNFQKPKPAKGKAEAHFSLVHYAGTVDYNIAGWLDKNK
DPLNETVVGLYQKSSLKLLSFLFSNYAGAETGDSGGSKKGGKKKGSSFQTVSAVFRENLN
KLMTNLRSTHPHFVRCLIPNETKTPGVMDHYLVMHQLRCNGVLEGIRICRKGFPSRILYA
DFKQRYRILNASAIPEGQFIDSKNASEKLLNSIDVDREQFRFGNTKVFFKAGLLGLLEEM
RDEKLVTLMTSTQAVCRGYLMRVEFKKMMERRDSIFCIQYNIRSFMNVKHWPWMNLFFKI
KPLLKSAEAEKEMATMKEDFERTKEELARSEARRKELEEKMVSLLQEKNDLQLQVQSETE
NLMDAEERCEGLIKSKILLEAKVKELTERLEEEEEMNSELVAKKRNLEDKCSSLKRDIDD
LELTLTKVEKEKHATENKVKNLSEEMTALEENISKLTKEKKSLQEAHQQTLDDLQVEEDK
VNGLIKINAKLEQQTDDLEGSLEQEKKLRADLERAKRKLEGDLKMSQESIMDLENDKQQI
EEKLKKKEFELSQLQAKIDDEQVHSLQFQKKIKELQARIEELEEEIEAEHTLRAKIEKQR
SDLARELEEISERLEEASGATSAQIEMNKKREAEFQKMRRDLEEATLQHEATAATLRKKQ
ADSVAELGEQIDNLQRVKQKLEKEKSELKMEIDDMASNIEALSKSKSNIERTCRTVEDQF
SEIKAKDEQQTQLIHDLNMQKARLQTQNGELSHRVEEKESLISQLTKSKQALTQQLEELK
RQMEEETKAKNAMAHALQSSRHDCDLLREQYEEEQEAKAELQRALSKANSEVAQWRTKYE
TDAIQRTEELEEAKKKLAQRLQEAEENTETANSKCASLEKTKQRLQGEVEDLMRDLERSH
TACATLDKKQRNFDKVLAEWKQKLDESQAELEAAQKESRSLSTELFKMRNAYEEVVDQLE
TLRRENKNLQEEISDLTEQIAETGKNLQEAEKTKKLVEQEKSDLQVALEEVEGSLEHEES
KILRVQLELSQVKSELDRKVIEKDEEIEQLKRNSQRAAEALQSVLDAEIRSRNDALRLKK
KMEGDLNEMEIQLGHSNRQMAETQKHLRTVQGQLKDSQLHLDDALRSNEDLKEQLAIVER
RNGLLLEELEEMKVALEQTERTRRLSEQELLDASDRVQLLHSQNTSLINTKKKLEADIAQ
CQAEVENSIQESRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHR
LDEAEQLALKGGKKQIQKLENRVRELENELDVEQKRGAEALKGAHKYERKVKEMTYQAEE
DHKNILRLQDLVDKLQAKVKSYKRQAEEAEEQANTQLSRCRRVQHELEEAAERADIAESQ
VNKLRAKSRDVGSQKMEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4pa0A	0.341	0.658	0.000	974	0.318	0.633	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
2	AFDB:A0A0G2JY53	0.654	0.661	0.000	1915	0.541	0.547	A0A0G2JY53.pdb.gz	A0A0G2JY53_RAT Myosin, heavy chain 15 OS=Rattus norvegicus OX=10116 GN=Myh15 PE=3 SV=2
3	AFDB:A0A0N4STT5	0.708	0.685	0.000	2008	0.761	0.735	A0A0N4STT5.pdb.gz
4	AFDB:A7E2Y1	0.702	0.687	0.000	1983	0.653	0.638	A7E2Y1.pdb.gz	MYH7B_HUMAN Myosin-7B OS=Homo sapiens OX=9606 GN=MYH7B PE=1 SV=4
5	AFDB:B1AR69	0.743	0.743	0.000	1938	0.960	0.960	B1AR69.pdb.gz	B1AR69_MOUSE Myosin, heavy polypeptide 13, skeletal muscle OS=Mus musculus OX=10090 GN=Myh13 PE=1 SV=1
6	AFDB:B3DFS9	0.654	0.643	0.000	1974	0.386	0.379	B3DFS9.pdb.gz
7	AFDB:B8A568	0.721	0.721	0.000	1937	0.794	0.794	B8A568.pdb.gz	B8A568_DANRE Myosin, heavy polypeptide 1.1, skeletal muscle OS=Danio rerio OX=7955 GN=cb20 PE=1 SV=1
8	AFDB:B8JLS3	0.720	0.721	0.000	1936	0.739	0.740	B8JLS3.pdb.gz
9	AFDB:E7FD18	0.760	0.757	0.000	1945	0.688	0.685	E7FD18.pdb.gz
10	AFDB:F1QC64	0.625	0.689	0.000	1749	0.344	0.381	F1QC64.pdb.gz
11	AFDB:F1R3G4	0.669	0.653	0.000	1992	0.382	0.372	F1R3G4.pdb.gz	F1R3G4_DANRE Myosin, heavy chain 10, non-muscle OS=Danio rerio OX=7955 GN=myh10 PE=1 SV=1
12	PDB:4pa0B	0.341	0.698	2.179E-102	920	0.311	0.655	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
13	PDB:4p7hB	0.340	0.674	2.249E-96	952	0.307	0.625	4p7hB.pdb.gz
14	PDB:5tbyA	0.368	0.712	2.630E-94	954	0.391	0.795	5tbyA.pdb.gz
15	PDB:7mf3B	0.365	0.769	1.787E-66	896	0.222	0.480	7mf3B.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
16	PDB:4anjA	0.341	0.651	5.475E-61	995	0.134	0.260	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
17	PDB:6ycxB	0.363	0.818	4.978E-56	817	0.119	0.283	6ycxB.pdb.gz	Full-length Plasmodium falciparum myosin A and essential light chain PfELC structures provide new anti-malarial targets.
18	PDB:7wrgA	0.048	0.092	9.307E-2	812	0.025	0.059	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
19	PDB:6fyxo	0.046	0.109	2.582E-1	529	0.034	0.123	6fyxo.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
20	PDB:7nkxZ	0.024	0.272	3.136E-1	156	0.005	0.058	7nkxZ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JY53	2095	1922	0.555	0.559	A0A0G2JY53_RAT Myosin, heavy chain 15 OS=Rattus norvegicus OX=10116 GN=Myh15 PE=3 SV=2
2	A0A0G2K0F5	3221	1912	0.811	0.822	A0A0G2K0F5_RAT Myosin heavy chain 2 OS=Rattus norvegicus OX=10116 GN=Myh2 PE=1 SV=2
3	A0A0G2K1V4	3224	1937	0.809	0.809	A0A0G2K1V4_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=2
4	A0A0G2K484	3271	1939	0.826	0.825	A0A0G2K484_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=2
5	A0A0R4INI3	3004	1938	0.766	0.766	A0A0R4INI3_DANRE Slow myosin heavy chain 1 OS=Danio rerio OX=7955 GN=fb18g10 PE=1 SV=1
6	A0A1D8PN92	698	1948	0.238	0.237	A0A1D8PN92_CANAL Myosin 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MYO1 PE=3 SV=1
7	A2AQP0	2488	1941	0.660	0.659	MYH7B_MOUSE Myosin-7B OS=Mus musculus OX=10090 GN=Myh7b PE=3 SV=1
8	A6QLN6	1237	1972	0.389	0.382	A6QLN6_BOVIN MYH11 protein OS=Bos taurus OX=9913 GN=MYH11 PE=1 SV=1
9	A7E2Y1	2486	1983	0.659	0.644	MYH7B_HUMAN Myosin-7B OS=Homo sapiens OX=9606 GN=MYH7B PE=1 SV=4
10	B1AR69	3819	1938	0.961	0.961	B1AR69_MOUSE Myosin, heavy polypeptide 13, skeletal muscle OS=Mus musculus OX=10090 GN=Myh13 PE=1 SV=1
11	B6IDE1	3009	1939	0.760	0.760	B6IDE1_DANRE Slow myosin heavy chain 2 OS=Danio rerio OX=7955 GN=MYH7 PE=1 SV=1
12	B6RK61	2510	1941	0.658	0.657	B6RK61_RAT Myosin heavy chain 7B OS=Rattus norvegicus OX=10116 GN=Myh7b PE=2 SV=1
13	B8A568	3121	1937	0.795	0.795	B8A568_DANRE Myosin, heavy polypeptide 1.1, skeletal muscle OS=Danio rerio OX=7955 GN=cb20 PE=1 SV=1
14	F1LMU0	3271	1939	0.826	0.826	F1LMU0_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh4 PE=1 SV=1
15	F1LRV9	3236	1943	0.816	0.814	F1LRV9_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=3
16	F1QZW1	3008	1938	0.765	0.765	F1QZW1_DANRE Myosin heavy chain 7 OS=Danio rerio OX=7955 GN=mg:cb02g011 PE=1 SV=1
17	F1R3G4	1195	1992	0.386	0.376	F1R3G4_DANRE Myosin, heavy chain 10, non-muscle OS=Danio rerio OX=7955 GN=myh10 PE=1 SV=1
18	F7F0L5	2451	1929	0.643	0.646	F7F0L5_RAT Myosin heavy chain 7B OS=Rattus norvegicus OX=10116 GN=Myh7b PE=3 SV=1
19	G3UW82	3248	1942	0.822	0.820	G3UW82_MOUSE Myosin, heavy polypeptide 2, skeletal muscle, adult OS=Mus musculus OX=10090 GN=Myh2 PE=1 SV=1
20	G3V6E1	3243	1942	0.820	0.819	G3V6E1_RAT Myosin heavy chain 2 OS=Rattus norvegicus OX=10116 GN=Myh2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13401 AAA_22	3.8e+02	12.8	AAA domain
2	PF19220 Crescentin	2e+02	12.4	Crescentin protein
3	PF07889 DUF1664	26	16.3	Protein of unknown function (DUF1664)
4	PF00612 IQ	29	15.8	IQ calmodulin-binding motif
5	PF00063 Myosin_head	2.5e-282	949.8	Myosin head (motor domain)
6	PF02736 Myosin_N	9.7e-08	42.9	Myosin N-terminal SH3-like domain
7	PF01576 Myosin_tail_1	1.1e-143	492.2	Myosin tail

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000404570

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000325239	0.979	Myosin light chain, phosphorylatable, fast skeletal muscle
2	9606.ENSP00000307280	0.978	Myosin light chain 1/3, skeletal muscle isoform
3	9606.ENSP00000383023	0.948	Myosin light chain 5
4	9606.ENSP00000450385	0.946	Myosin light chain 6B
5	9606.ENSP00000279022	0.943	Myosin regulatory light polypeptide 9
6	9606.ENSP00000379210	0.942	Myosin light chain 3
7	9606.ENSP00000384330	0.935	Myosin-8
8	9606.ENSP00000353590	0.924	Myosin-10
9	9606.ENSP00000226207	0.912	Myosin-1
10	9606.ENSP00000245503	0.906	Myosin-2
11	9606.ENSP00000386041	0.904	Myosin-6
12	9606.ENSP00000470298	0.904	Myosin-14
13	9606.ENSP00000216181	0.900	Myosin-9
14	9606.ENSP00000347507	0.900	Myosin-7
15	9606.ENSP00000463559	0.880	Myosin regulatory light chain 12B
16	9606.ENSP00000290378	0.834	Actin, alpha cardiac muscle 1
17	9606.ENSP00000223167	0.825	Myosin regulatory light chain 10
18	9606.ENSP00000217652	0.824	Myosin regulatory light chain 12A
19	9606.ENSP00000446955	0.813	Myosin light polypeptide 6
20	9606.ENSP00000223364	0.810	Myosin regulatory light chain 2, atrial isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0000146	0.997	microfilament motor activity
GO:0008092	0.918	cytoskeletal protein binding
GO:0003779	0.913	actin binding
GO:0044877	0.784	protein-containing complex binding
GO:0051015	0.576	actin filament binding
GO:1901363	0.404	heterocyclic compound binding
GO:0097159	0.402	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.990	multicellular organismal process
GO:0009987	0.987	cellular process
GO:0032502	0.969	developmental process
GO:0003008	0.966	system process
GO:0048856	0.955	anatomical structure development
GO:0061061	0.866	muscle structure development
GO:0003012	0.834	muscle system process
GO:0051146	0.821	striated muscle cell differentiation
GO:0055001	0.820	muscle cell development
GO:0006936	0.684	muscle contraction
GO:0009653	0.676	anatomical structure morphogenesis
GO:0065007	0.665	biological regulation
GO:0030029	0.621	actin filament-based process
GO:0071840	0.489	cellular component organization or biogenesis
GO:0050789	0.467	regulation of biological process
GO:0016043	0.421	cellular component organization
GO:0007275	0.368	multicellular organism development
GO:0050896	0.362	response to stimulus
GO:0048513	0.319	animal organ development
GO:0006941	0.307	striated muscle contraction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043292	0.997	contractile fiber
GO:0032991	0.987	protein-containing complex
GO:0005829	0.919	cytosol
GO:0005856	0.905	cytoskeleton
GO:0015629	0.881	actin cytoskeleton
GO:0043227	0.875	membrane-bounded organelle
GO:0030016	0.752	myofibril
GO:0005859	0.564	muscle myosin complex
GO:0043231	0.445	intracellular membrane-bounded organelle
GO:0030017	0.379	sarcomere
GO:0070062	0.358	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.8	0.997	myosin ATPase.

[back to server]