StarFunc result for job id Q9UKX5

User Input

>input (1188 residues)
MDLPRGLVVAWALSLWPGFTDTFNMDTRKPRVIPGSRTAFFGYTVQQHDISGNKWLVVGA
PLETNGYQKTGDVYKCPVIHGNCTKLNLGRVTLSNVSERKDNMRLGLSLATNPKDNSFLA
CSPLWSHECGSSYYTTGMCSRVNSNFRFSKTVAPALQRCQTYMDIVIVLDGSNSIYPWVE
VQHFLINILKKFYIGPGQIQVGVVQYGEDVVHEFHLNDYRSVKDVVEAASHIEQRGGTET
RTAFGIEFARSEAFQKGGRKGAKKVMIVITDGESHDSPDLEKVIQQSERDNVTRYAVAVL
GYYNRRGINPETFLNEIKYIASDPDDKHFFNVTDEAALKDIVDALGDRIFSLEGTNKNET
SFGLEMSQTGFSSHVVEDGVLLGAVGAYDWNGAVLKETSAGKVIPLRESYLKEFPEELKN
HGAYLGYTVTSVVSSRQGRVYVAGAPRFNHTGKVILFTMHNNRSLTIHQAMRGQQIGSYF
GSEITSVDIDGDGVTDVLLVGAPMYFNEGRERGKVYVYELRQNLFVYNGTLKDSHSYQNA
RFGSSIASVRDLNQDSYNDVVVGAPLEDNHAGAIYIFHGFRGSILKTPKQRITASELATG
LQYFGCSIHGQLDLNEDGLIDLAVGALGNAVILWSRPVVQINASLHFEPSKINIFHRDCK
RSGRDATCLAAFLCFTPIFLAPHFQTTTVGIRYNATMDERRYTPRAHLDEGGDRFTNRAV
LLSSGQELCERINFHVLDTADYVKPVTFSVEYSLEDPDHGPMLDDGWPTTLRVSVPFWNG
CNEDEHCVPDLVLDARSDLPTAMEYCQRVLRKPAQDCSAYTLSFDTTVFIIESTRQRVAV
EATLENRGENAYSTVLNISQSANLQFASLIQKEDSDGSIECVNEERRLQKQVCNVSYPFF
RAKAKVAFRLDFEFSKSIFLHHLEIELAAGSDSNERDSTKEDNVAPLRFHLKYEADVLFT
RSSSLSHYEVKPNSSLERYDGIGPPFSCIFRIQNLGLFPIHGMMMKITIPIATRSGNRLL
KLRDFLTDEANTSCNIWGNSTEYRPTPVEEDLRRAPQLNHSNSDVVSINCNIRLVPNQEI
NFHLLGNLWLRSLKALKYKSMKIMVNAALQRQFHSPFIFREEDPSRQIVFEISKQEDWQV
PIWIIVGSTLGGLLLLALLVLALWKLGFFRSARRRREPGLDPTPKVLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K470	0.657	0.663	0.000	1178	0.361	0.364	A0A0G2K470.pdb.gz	A0A0G2K470_RAT Integrin subunit alpha 2 OS=Rattus norvegicus OX=10116 GN=Itga2 PE=3 SV=1
2	AFDB:O75578	0.679	0.690	0.000	1167	0.432	0.440	O75578.pdb.gz	ITA10_HUMAN Integrin alpha-10 OS=Homo sapiens OX=9606 GN=ITGA10 PE=2 SV=2
3	AFDB:P17301	0.638	0.641	0.000	1181	0.345	0.347	P17301.pdb.gz	ITA2_HUMAN Integrin alpha-2 OS=Homo sapiens OX=9606 GN=ITGA2 PE=1 SV=2
4	AFDB:P18614	0.614	0.618	0.000	1180	0.387	0.390	P18614.pdb.gz	ITA1_RAT Integrin alpha-1 OS=Rattus norvegicus OX=10116 GN=Itga1 PE=1 SV=1
5	AFDB:P56199	0.638	0.643	0.000	1179	0.385	0.388	P56199.pdb.gz	ITA1_HUMAN Integrin alpha-1 OS=Homo sapiens OX=9606 GN=ITGA1 PE=1 SV=2
6	AFDB:P61622	0.876	0.876	0.000	1188	0.901	0.901	P61622.pdb.gz	ITA11_MOUSE Integrin alpha-11 OS=Mus musculus OX=10090 GN=Itga11 PE=1 SV=1
7	AFDB:Q9QYE7	0.543	0.555	3.995E-99	1161	0.287	0.294	Q9QYE7.pdb.gz	ITAD_RAT Integrin alpha-D OS=Rattus norvegicus OX=10116 GN=Itgad PE=2 SV=1
8	AFDB:Q13349	0.587	0.600	6.115E-98	1161	0.287	0.294	Q13349.pdb.gz	ITAD_HUMAN Integrin alpha-D OS=Homo sapiens OX=9606 GN=ITGAD PE=1 SV=2
9	AFDB:Q3V0T4	0.470	0.477	6.873E-97	1168	0.285	0.290	Q3V0T4.pdb.gz	ITAD_MOUSE Integrin alpha-D OS=Mus musculus OX=10090 GN=Itgad PE=1 SV=1
10	AFDB:Q9QXH4	0.556	0.565	1.037E-96	1169	0.285	0.289	Q9QXH4.pdb.gz	ITAX_MOUSE Integrin alpha-X OS=Mus musculus OX=10090 GN=Itgax PE=1 SV=1
11	PDB:4nehA	0.447	0.486	3.077E-88	1084	0.251	0.275	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
12	PDB:4nenA	0.446	0.495	1.561E-85	1063	0.243	0.272	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
13	PDB:7uslA	0.418	0.571	1.418E-66	856	0.196	0.272	7uslA.pdb.gz	Structural basis for non-canonical integrin engagement by Bordetella adenylate cyclase toxin.
14	PDB:4g1eA	0.404	0.491	4.042E-61	964	0.187	0.230	4g1eA.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
15	PDB:3k6sC	0.412	0.543	1.994E-60	885	0.196	0.263	3k6sC.pdb.gz	Structure of an integrin with an alphaI domain, complement receptor type 4.
16	PDB:3fcsA	0.398	0.509	1.947E-58	913	0.167	0.217	3fcsA.pdb.gz	Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.
17	PDB:7nxdA	0.424	0.548	2.792E-58	905	0.184	0.241	7nxdA.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
18	PDB:5a42A	0.099	0.081	7.626E-8	1597	0.074	0.055	5a42A.pdb.gz
19	PDB:4rtdA	0.076	0.079	8.900E-8	1122	0.052	0.055	4rtdA.pdb.gz
20	PDB:2xwbF	0.149	0.232	2.762E-7	714	0.061	0.102	2xwbF.pdb.gz	Structures of C3B in Complex with Factors B and D Give Insight Into Complement Convertase Formation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K470	0.0	748	1178	0.371	0.374	A0A0G2K470_RAT Integrin subunit alpha 2 OS=Rattus norvegicus OX=10116 GN=Itga2 PE=3 SV=1
2	O75578	0.0	919	1167	0.434	0.441	ITA10_HUMAN Integrin alpha-10 OS=Homo sapiens OX=9606 GN=ITGA10 PE=2 SV=2
3	P17301	0.0	711	1181	0.360	0.362	ITA2_HUMAN Integrin alpha-2 OS=Homo sapiens OX=9606 GN=ITGA2 PE=1 SV=2
4	P18614	0.0	810	1180	0.393	0.396	ITA1_RAT Integrin alpha-1 OS=Rattus norvegicus OX=10116 GN=Itga1 PE=1 SV=1
5	P56199	0.0	825	1179	0.391	0.394	ITA1_HUMAN Integrin alpha-1 OS=Homo sapiens OX=9606 GN=ITGA1 PE=1 SV=2
6	P61622	0.0	2234	1188	0.902	0.902	ITA11_MOUSE Integrin alpha-11 OS=Mus musculus OX=10090 GN=Itga11 PE=1 SV=1
7	Q3V3R4	0.0	806	1179	0.391	0.394	ITA1_MOUSE Integrin alpha-1 OS=Mus musculus OX=10090 GN=Itga1 PE=1 SV=2
8	Q62469	0.0	749	1178	0.368	0.371	ITA2_MOUSE Integrin alpha-2 OS=Mus musculus OX=10090 GN=Itga2 PE=1 SV=2
9	Q9UKX5	0.0	2473	1188	1.000	1.000	ITA11_HUMAN Integrin alpha-11 OS=Homo sapiens OX=9606 GN=ITGA11 PE=1 SV=2
10	Q9QYE7	5.10e-129	426	1161	0.301	0.307	ITAD_RAT Integrin alpha-D OS=Rattus norvegicus OX=10116 GN=Itgad PE=2 SV=1
11	Q3V0T4	1.22e-127	422	1168	0.302	0.307	ITAD_MOUSE Integrin alpha-D OS=Mus musculus OX=10090 GN=Itgad PE=1 SV=1
12	Q9QXH4	1.53e-125	417	1169	0.300	0.305	ITAX_MOUSE Integrin alpha-X OS=Mus musculus OX=10090 GN=Itgax PE=1 SV=1
13	Q13349	3.28e-118	397	1161	0.290	0.297	ITAD_HUMAN Integrin alpha-D OS=Homo sapiens OX=9606 GN=ITGAD PE=1 SV=2
14	Q9JI30	2.49e-117	394	1151	0.294	0.303	Q9JI30_RAT Integrin beta 2 alpha subunit OS=Rattus norvegicus OX=10116 GN=Itgam PE=2 SV=1
15	G3V8L7	2.87e-117	394	1151	0.290	0.299	G3V8L7_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=3 SV=2
16	A0A0G2K4L8	3.65e-117	394	1151	0.290	0.299	A0A0G2K4L8_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=3 SV=2
17	P05555	5.84e-117	393	1153	0.295	0.304	ITAM_MOUSE Integrin alpha-M OS=Mus musculus OX=10090 GN=Itgam PE=1 SV=2
18	P20701	4.50e-116	391	1170	0.262	0.266	ITAL_HUMAN Integrin alpha-L OS=Homo sapiens OX=9606 GN=ITGAL PE=1 SV=3
19	P20702	6.65e-116	390	1163	0.285	0.291	ITAX_HUMAN Integrin alpha-X OS=Homo sapiens OX=9606 GN=ITGAX PE=1 SV=3
20	A0A8I5Y8A4	1.40e-115	389	1141	0.287	0.299	A0A8I5Y8A4_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01839 FG-GAP	1.2e-20	84.1	FG-GAP repeat
2	PF14312 FG-GAP_2	1.5e-05	36.5	FG-GAP repeat
3	PF13517 FG-GAP_3	0.016	27.1	FG-GAP-like repeat
4	PF08441 Integrin_alpha2	6.2e-38	142.7	Integrin alpha
5	PF03731 Ku_N	89	14.3	Ku70/Ku80 N-terminal alpha/beta domain
6	PF02875 Mur_ligase_C	5.3e+02	12.3	Mur ligase family, glutamate ligase domain
7	PF00092 VWA	1.2e-37	141.4	von Willebrand factor type A domain
8	PF13519 VWA_2	6.5e-11	54.2	von Willebrand factor type A domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000327290

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379350	0.988	Integrin beta-1
2	9606.ENSP00000222573	0.967	Integrin beta-8
3	9606.ENSP00000283249	0.967	Integrin beta-6
4	9606.ENSP00000296181	0.967	Integrin beta-5
5	9606.ENSP00000267082	0.963	Integrin beta-7
6	9606.ENSP00000452786	0.961	Integrin beta-3
7	9606.ENSP00000380948	0.956	Integrin beta-2
8	9606.ENSP00000297268	0.947	Collagen alpha-2(I) chain
9	9606.ENSP00000225964	0.942	Collagen alpha-1(I) chain
10	9606.ENSP00000200181	0.926	Integrin beta-4
11	9606.ENSP00000007722	0.924	Integrin alpha-3
12	9606.ENSP00000261023	0.923	Integrin alpha-V
13	9606.ENSP00000293379	0.922	Integrin alpha-5
14	9606.ENSP00000373854	0.920	Integrin alpha-D
15	9606.ENSP00000367316	0.918	Integrin alpha-8
16	9606.ENSP00000380227	0.918	Integrin alpha-4
17	9606.ENSP00000282588	0.912	Integrin alpha-1
18	9606.ENSP00000296585	0.908	Integrin alpha-2
19	9606.ENSP00000358310	0.906	Integrin alpha-10
20	9606.ENSP00000299106	0.905	Junctional adhesion molecule C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005518	1.000	collagen binding
GO:0050839	0.987	cell adhesion molecule binding
GO:0005102	0.834	signaling receptor binding
GO:0098631	0.749	cell adhesion mediator activity
GO:0060089	0.586	molecular transducer activity
GO:0038023	0.584	signaling receptor activity
GO:0004888	0.401	transmembrane signaling receptor activity
GO:0098634	0.376	cell-matrix adhesion mediator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048870	0.985	cell motility
GO:0065007	0.975	biological regulation
GO:0050794	0.965	regulation of cellular process
GO:0007155	0.892	cell adhesion
GO:0032501	0.884	multicellular organismal process
GO:0016477	0.878	cell migration
GO:0032502	0.853	developmental process
GO:0048856	0.795	anatomical structure development
GO:0050896	0.716	response to stimulus
GO:0051716	0.611	cellular response to stimulus
GO:0031589	0.557	cell-substrate adhesion
GO:0007154	0.454	cell communication
GO:0023052	0.450	signaling
GO:0007160	0.450	cell-matrix adhesion
GO:0007165	0.442	signal transduction
GO:0030154	0.425	cell differentiation
GO:0048518	0.400	positive regulation of biological process
GO:0007229	0.348	integrin-mediated signaling pathway
GO:0071840	0.325	cellular component organization or biogenesis
GO:0048522	0.302	positive regulation of cellular process
GO:0007275	0.300	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0032991	0.998	protein-containing complex
GO:0043235	0.903	receptor complex
GO:0005925	0.873	focal adhesion
GO:0009986	0.860	cell surface
GO:0098636	0.808	protein complex involved in cell adhesion
GO:0098797	0.795	plasma membrane protein complex
GO:0098802	0.786	plasma membrane signaling receptor complex
GO:0008305	0.782	integrin complex
GO:0005737	0.700	cytoplasm
GO:0043226	0.666	organelle
GO:0043227	0.563	membrane-bounded organelle
GO:0043231	0.521	intracellular membrane-bounded organelle
GO:0005576	0.448	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]