StarFunc result for job id Q9UKY1

User Input

>input (873 residues)
MASRRKSTTPCMVLASEQDPDLELISDLDEGPPVLTPVENTRAESISSDEEVHESVDSDN
QQNKKVEGGYECKYCTFQTPDLNMFTFHVDSEHPNVVLNSSYVCVECNFLTKRYDALSEH
NLKYHPGEENFKLTMVKRNNQTIFEQTINDLTFDGSFVKEENAEQAESTEVSSSGISISK
TPIMKMMKNKVENKRIAVHHNSVEDVPEEKENEIKPDREEIVENPSSSASESNTSTSIVN
RIHPSTASTVVTPAAVLPGLAQVITAVSAQQNSNLIPKVLIPVNSIPTYNAALDNNPLLL
NTYNKFPYPTMSEITVLSAQAKYTEEQIKIWFSAQRLKHGVSWTPEEVEEARRKQFNGTV
HTVPQTITVIPTHISTGSNGLPSILQTCQIVGQPGLVLTQVAGTNTLPVTAPIALTVAGV
PSQNNIQKSQVPAAQPTAETKPATAAVPTSQSVKHETALVNPDSFGIRAKKTKEQLAELK
VSYLKNQFPHDSEIIRLMKITGLTKGEIKKWFSDTRYNQRNSKSNQCLHLNNDSSTTIII
DSSDETTESPTVGTAQPKQSWNPFPDFTPQKFKEKTAEQLRVLQASFLNSSVLTDEELNR
LRAQTKLTRREIDAWFTEKKKSKALKEEKMEIDESNAGSSKEEAGETSPADESGAPKSGS
TGKICKKTPEQLHMLKSAFVRTQWPSPEEYDKLAKESGLARTDIVSWFGDTRYAWKNGNL
KWYYYYQSANSSSMNGLSSLRKRGRGRPKGRGRGRPRGRPRGSKRINNWDRGPSLIKFKT
GTAILKDYYLKHKFLNEQDLDELVNKSHMGYEQVREWFAERQRRSELGIELFEENEEEDE
VIDDQEEDEEETDDSDTWEPPRHVKRKLSKSDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R9F1	0.253	0.253	0.000	873	1.000	1.000	A0A024R9F1.pdb.gz
2	AFDB:Q9H4I2	0.261	0.242	2.570E-49	956	0.380	0.347	Q9H4I2.pdb.gz	ZHX3_HUMAN Zinc fingers and homeoboxes protein 3 OS=Homo sapiens OX=9606 GN=ZHX3 PE=1 SV=3
3	AFDB:Q80Z36	0.249	0.232	1.786E-45	951	0.359	0.329	Q80Z36.pdb.gz	ZHX3_RAT Zinc fingers and homeoboxes protein 3 OS=Rattus norvegicus OX=10116 GN=Zhx3 PE=1 SV=2
4	AFDB:P31368	0.081	0.109	6.194E-4	601	0.094	0.136	P31368.pdb.gz	PDM1_DROME Protein nubbin OS=Drosophila melanogaster OX=7227 GN=nub PE=2 SV=1
5	AFDB:F5HGI6	0.063	0.069	1.626E-3	783	0.142	0.158	F5HGI6.pdb.gz	F5HGI6_CRYNB HSF-type DNA-binding domain-containing protein OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=CNBB5560 PE=3 SV=1
6	AFDB:Q9NJB5	0.080	0.069	1.716E-3	1081	0.111	0.090	Q9NJB5.pdb.gz	ONEC_DROME Homeobox protein onecut OS=Drosophila melanogaster OX=7227 GN=onecut PE=2 SV=2
7	AFDB:Q38EZ3	0.057	0.042	9.539E-3	1346	0.129	0.084	Q38EZ3.pdb.gz	Q38EZ3_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.4120 PE=4 SV=1
8	AFDB:O75362	0.071	0.062	1.120E-2	1048	0.093	0.077	O75362.pdb.gz	ZN217_HUMAN Zinc finger protein 217 OS=Homo sapiens OX=9606 GN=ZNF217 PE=1 SV=1
9	AFDB:A5JNG8	0.069	0.141	1.546E-2	384	0.080	0.182	A5JNG8.pdb.gz	A5JNG8_DANRE Nanog OS=Danio rerio OX=7955 GN=fd20a07 PE=2 SV=1
10	AFDB:P10105	0.076	0.102	1.720E-2	635	0.090	0.124	P10105.pdb.gz	LAB_DROME Homeotic protein labial OS=Drosophila melanogaster OX=7227 GN=lab PE=1 SV=2
11	PDB:2hi3A	0.062	0.584	1.681E-1	73	0.018	0.219	2hi3A.pdb.gz
12	PDB:4egcA	0.057	0.092	1.975E-1	539	0.016	0.026	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
13	PDB:7ksrC	0.046	0.089	4.913E-1	397	0.017	0.038	7ksrC.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
14	PDB:6wkrA	0.046	0.081	6.777E-1	439	0.014	0.027	6wkrA.pdb.gz	JARID2 and AEBP2 regulate PRC2 in the presence of H2AK119ub1 and other histone modifications.
15	PDB:7btaB	0.033	0.142	1.980	145	0.010	0.062	7btaB.pdb.gz	Molecular basis for the functions of dominantly active Y35N and inactive D60K Rheb mutants in mTORC1 signaling.
16	PDB:7ksoC	0.043	0.078	1.980	420	0.014	0.029	7ksoC.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
17	PDB:3doeA	0.028	0.101	2.089	189	0.007	0.032	3doeA.pdb.gz	Crystal structure of the ARL2-GTP-BART complex reveals a novel recognition and binding mode of small GTPase with effector
18	PDB:1uptG	0.022	0.110	2.204	170	0.003	0.018	1uptG.pdb.gz	Structural Basis for Arl1-Dependent Targeting of Homodimeric Grip Domains to the Golgi Apparatus
19	PDB:4aybB	0.042	0.034	2.326	1103	0.006	0.005	4aybB.pdb.gz	Structural and Functional Analyses of the Interaction of Archaeal RNA Polymerase with DNA.
20	PDB:6y7gB	0.022	0.113	2.326	165	0.007	0.036	6y7gB.pdb.gz	Structure of the human RAB3C in complex with GDP

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P70121	0.0	1518	873	0.913	0.913	ZHX1_MOUSE Zinc fingers and homeoboxes protein 1 OS=Mus musculus OX=10090 GN=Zhx1 PE=1 SV=2
2	Q8R515	0.0	1504	873	0.924	0.924	ZHX1_RAT Zinc fingers and homeoboxes protein 1 OS=Rattus norvegicus OX=10116 GN=Zhx1 PE=1 SV=1
3	Q9UKY1	0.0	1813	873	1.000	1.000	ZHX1_HUMAN Zinc fingers and homeoboxes protein 1 OS=Homo sapiens OX=9606 GN=ZHX1 PE=1 SV=1
4	Q9Y6X8	0.0	556	837	0.399	0.416	ZHX2_HUMAN Zinc fingers and homeoboxes protein 2 OS=Homo sapiens OX=9606 GN=ZHX2 PE=1 SV=1
5	Q8C0C0	4.64e-174	526	836	0.370	0.386	ZHX2_MOUSE Zinc fingers and homeoboxes protein 2 OS=Mus musculus OX=10090 GN=Zhx2 PE=1 SV=1
6	Q9H4I2	7.31e-160	493	956	0.387	0.354	ZHX3_HUMAN Zinc fingers and homeoboxes protein 3 OS=Homo sapiens OX=9606 GN=ZHX3 PE=1 SV=3
7	Q8C0Q2	6.71e-148	462	951	0.373	0.343	ZHX3_MOUSE Zinc fingers and homeoboxes protein 3 OS=Mus musculus OX=10090 GN=Zhx3 PE=1 SV=2
8	H0Y6F5	6.74e-122	385	678	0.282	0.363	H0Y6F5_HUMAN Zinc fingers and homeoboxes 3 (Fragment) OS=Homo sapiens OX=9606 GN=ZHX3 PE=1 SV=1
9	Q80Z36	3.33e-114	373	951	0.294	0.270	ZHX3_RAT Zinc fingers and homeoboxes protein 3 OS=Rattus norvegicus OX=10116 GN=Zhx3 PE=1 SV=2
10	A0A669KB72	2.19e-18	91.3	439	0.086	0.171	A0A669KB72_HUMAN Homeobox and leucine zipper encoding OS=Homo sapiens OX=9606 GN=HOMEZ PE=1 SV=1
11	Q80W88	4.19e-16	84.7	542	0.061	0.098	HOMEZ_MOUSE Homeobox and leucine zipper protein Homez OS=Mus musculus OX=10090 GN=Homez PE=1 SV=2
12	Q8IX15	1.68e-14	79.7	550	0.058	0.093	HOMEZ_HUMAN Homeobox and leucine zipper protein Homez OS=Homo sapiens OX=9606 GN=HOMEZ PE=1 SV=2
13	U3KPW8	2.00e-13	74.7	324	0.038	0.102	U3KPW8_HUMAN Homeobox and leucine zipper encoding (Fragment) OS=Homo sapiens OX=9606 GN=HOMEZ PE=1 SV=3
14	Q15911	1.95e-06	54.3	3703	0.069	0.016	ZFHX3_HUMAN Zinc finger homeobox protein 3 OS=Homo sapiens OX=9606 GN=ZFHX3 PE=1 SV=2
15	F1M4Q6	8.13e-06	52.4	3730	0.068	0.016	F1M4Q6_RAT Zinc finger homeobox 3 OS=Rattus norvegicus OX=10116 GN=Zfhx3 PE=4 SV=3
16	Q61329	8.41e-06	52.4	3726	0.068	0.016	ZFHX3_MOUSE Zinc finger homeobox protein 3 OS=Mus musculus OX=10090 GN=Zfhx3 PE=1 SV=1
17	Q9JJN2	2.08e-04	47.8	3550	0.047	0.012	ZFHX4_MOUSE Zinc finger homeobox protein 4 OS=Mus musculus OX=10090 GN=Zfhx4 PE=1 SV=1
18	A6NLW8	0.001	43.1	204	0.021	0.088	DUXA_HUMAN Double homeobox protein A OS=Homo sapiens OX=9606 GN=DUXA PE=2 SV=1
19	P17486	0.004	42.0	223	0.026	0.103	EGL5_CAEEL Homeobox protein egl-5 OS=Caenorhabditis elegans OX=6239 GN=egl-5 PE=1 SV=4
20	Q9VPL4	0.009	41.6	294	0.031	0.092	Q9VPL4_DROME RE08174p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG11617 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00118 Cpn60_TCP1	1.1e+02	12.8	TCP-1/cpn60 chaperonin family
2	PF05920 Homeobox_KN	4.7e-16	69.7	Homeobox KN domain
3	PF00046 Homeodomain	8.2e-32	120.2	Homeodomain
4	PF11569 Homez	2.6e-07	41.5	Homeodomain leucine-zipper encoding, Homez
5	PF15615 TerB_C	33	16.2	TerB-C domain
6	PF18387 zf_C2H2_ZHX	1.2e-19	81.1	Zinc-fingers and homeoboxes C2H2 finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000297857

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000345702	0.968	Nuclear transcription factor Y subunit alpha
2	9606.ENSP00000328547	0.877	DNA (cytosine-5)-methyltransferase 3B
3	9606.ENSP00000376840	0.813	Bisphosphoglycerate mutase
4	9606.ENSP00000381053	0.705	Zinc finger MYND domain-containing protein 11
5	9606.ENSP00000396620	0.679	Nuclear transcription factor Y subunit gamma
6	9606.ENSP00000259512	0.646	Derlin-1
7	9606.ENSP00000252011	0.632	Probable ATP-dependent RNA helicase DHX35
8	9606.ENSP00000287394	0.607	ATPase family AAA domain-containing protein 2
9	9606.ENSP00000348056	0.606	SUMO-conjugating enzyme UBC9
10	9606.ENSP00000338964	0.600	Glutathione hydrolase 7
11	9606.ENSP00000428876	0.569	Protein FAM83A
12	9606.ENSP00000314709	0.550	Zinc fingers and homeoboxes protein 2
13	9606.ENSP00000354522	0.545	DNA topoisomerase 1
14	9606.ENSP00000240055	0.539	Nuclear transcription factor Y subunit beta
15	9606.ENSP00000040584	0.536	Homeobox protein Hox-C8
16	9606.ENSP00000306991	0.535	Hyaluronan synthase 2
17	9606.ENSP00000377836	0.535	Glypican-3
18	9606.ENSP00000265069	0.534	Zinc finger RNA-binding protein
19	9606.ENSP00000407726	0.531	Von Willebrand factor A domain-containing protein 5A
20	9606.ENSP00000237530	0.525	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0046982	0.997	protein heterodimerization activity
GO:0003676	0.995	nucleic acid binding
GO:0003677	0.984	DNA binding
GO:0043565	0.881	sequence-specific DNA binding
GO:0003690	0.848	double-stranded DNA binding
GO:1990837	0.838	sequence-specific double-stranded DNA binding
GO:0000981	0.656	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0042802	0.534	identical protein binding
GO:0042803	0.364	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006355	0.997	regulation of DNA-templated transcription
GO:0031327	0.950	negative regulation of cellular biosynthetic process
GO:0010558	0.947	negative regulation of macromolecule biosynthetic process
GO:0045934	0.947	negative regulation of nucleobase-containing compound metabolic process
GO:1902679	0.942	negative regulation of RNA biosynthetic process
GO:0045892	0.923	negative regulation of DNA-templated transcription
GO:0006357	0.567	regulation of transcription by RNA polymerase II
GO:0000122	0.397	negative regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.416	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]