StarFunc result for job id Q9UKY4

User Input

>input (750 residues)
MPPATGGGLAESELRPRRGRCGPQAARAAGRDVAAEAVARSPKRPAWGSRRFEAVGWWAL
LALVTLLSFATRFHRLDEPPHICWDETHFGKMGSYYINRTFFFDVHPPLGKMLIGLAGYL
SGYDGTFLFQKPGDKYEHHSYMGMRGFCAFLGSWLVPFAYLTVLDLSKSLSAALLTAALL
TFDTGCLTLSQYILLDPILMFFIMAAMLSMVKYNSCADRPFSAPWWFWLSLTGVSLAGAL
GVKFVGLFIILQVGLNTIADLWYLFGDLSLSLVTVGKHLTARVLCLIVLPLALYTATFAV
HFMVLSKSGPGDGFFSSAFQARLSGNNLHNASIPEHLAYGSVITVKNLRMAIGYLHSHRH
LYPEGIGARQQQVTTYLHKDYNNLWIIKKHNTNSDPLDPSFPVEFVRHGDIIRLEHKETS
RNLHSHYHEAPMTRKHYQVTGYGINGTGDSNDFWRIEVVNRKFGNRIKVLRSRIRFIHLV
TGCVLGSSGKVLPKWGWEQLEVTCTPYLKETLNSIWNVEDHINPKLPNISLDVLQPSFPE
ILLESHMVMIRGNSGLKPKDNEFTSKPWHWPINYQGLRFSGVNDTDFRVYLLGNPVVWWL
NLLSIALYLLSGSIIAVAMQRGARLPAEVAGLSQVLLRGGGQVLLGWTLHYFPFFLMGRV
LYFHHYFPAMLFSSMLTGILWDTLLRLCAWGLASWPLARGIHVAGILSLLLGTAYSFYLF
HPLAYGMVGPLAQDPQSPMAGLRWLDSWDF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14U74	0.980	0.896	0.000	820	0.897	0.821	Q14U74.pdb.gz	Q14U74_RAT Dolichyl-phosphate-mannose--protein mannosyltransferase OS=Rattus norvegicus OX=10116 GN=Pomt2 PE=3 SV=1
2	AFDB:Q9UKY4	1.000	1.000	0.000	750	1.000	1.000	Q9UKY4.pdb.gz	POMT2_HUMAN Protein O-mannosyl-transferase 2 OS=Homo sapiens OX=9606 GN=POMT2 PE=1 SV=2
3	AFDB:F1Q8R9	0.910	0.903	8.111E-88	756	0.653	0.648	F1Q8R9.pdb.gz	POMT2_DANRE Protein O-mannosyl-transferase 2 OS=Danio rerio OX=7955 GN=pomt2 PE=1 SV=1
4	AFDB:Q9W5D4	0.901	0.883	4.937E-73	765	0.511	0.501	Q9W5D4.pdb.gz	POMT2_DROME Protein O-mannosyl-transferase 2 OS=Drosophila melanogaster OX=7227 GN=tw PE=2 SV=1
5	AFDB:G5EB59	0.839	0.849	1.403E-56	740	0.375	0.380	G5EB59.pdb.gz	G5EB59_EMENI Dolichyl-phosphate-mannose--protein mannosyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05105 PE=3 SV=1
6	AFDB:Q6FUT7	0.803	0.819	2.181E-53	734	0.345	0.353	Q6FUT7.pdb.gz	Q6FUT7_CANGA Dolichyl-phosphate-mannose--protein mannosyltransferase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0F00759g PE=3 SV=1
7	AFDB:Q5ADM9	0.838	0.819	4.110E-53	769	0.337	0.329	Q5ADM9.pdb.gz	PMT2_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT2 PE=1 SV=1
8	AFDB:P31382	0.837	0.828	5.296E-53	759	0.336	0.332	P31382.pdb.gz	PMT2_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT2 PE=1 SV=2
9	AFDB:Q9C100	0.797	0.808	1.233E-52	739	0.343	0.348	Q9C100.pdb.gz	PMT2_SCHPO Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm2 PE=3 SV=1
10	AFDB:Q4WWN0	0.792	0.639	4.565E-52	946	0.356	0.282	Q4WWN0.pdb.gz	Q4WWN0_ASPFU Dolichyl-phosphate-mannose--protein mannosyltransferase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_3G06450 PE=3 SV=1
11	PDB:6p25B	0.747	0.805	1.197E-47	690	0.335	0.364	6p25B.pdb.gz	Structure of the eukaryotic protein O-mannosyltransferase Pmt1-Pmt2 complex.
12	PDB:6p25A	0.798	0.818	1.097E-43	731	0.316	0.324	6p25A.pdb.gz	Structure of the eukaryotic protein O-mannosyltransferase Pmt1-Pmt2 complex.
13	PDB:3malA	0.220	0.875	1.534E-10	181	0.071	0.293	3malA.pdb.gz
14	PDB:1t9fA	0.212	0.852	3.280E-10	178	0.072	0.303	1t9fA.pdb.gz
15	PDB:7t3qA	0.194	0.073	3.873E-6	2103	0.069	0.025	7t3qA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
16	PDB:7t3rA	0.197	0.073	4.990E-6	2130	0.072	0.025	7t3rA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
17	PDB:7t3pA	0.191	0.073	1.628E-5	2066	0.064	0.023	7t3pA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
18	PDB:7rroE	0.200	0.531	1.808E-4	255	0.044	0.129	7rroE.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
19	PDB:6dr0C	0.188	0.068	3.867E-4	2193	0.073	0.025	6dr0C.pdb.gz	Structural basis for the regulation of inositol trisphosphate receptors by Ca2+and IP3.
20	PDB:7ungE	0.204	0.501	4.208E-4	277	0.041	0.112	7ungE.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1Q8R9	0.0	1000	756	0.652	0.647	POMT2_DANRE Protein O-mannosyl-transferase 2 OS=Danio rerio OX=7955 GN=pomt2 PE=1 SV=1
2	Q14U74	0.0	1353	820	0.897	0.821	Q14U74_RAT Dolichyl-phosphate-mannose--protein mannosyltransferase OS=Rattus norvegicus OX=10116 GN=Pomt2 PE=3 SV=1
3	Q9UKY4	0.0	1535	750	1.000	1.000	POMT2_HUMAN Protein O-mannosyl-transferase 2 OS=Homo sapiens OX=9606 GN=POMT2 PE=1 SV=2
4	Q9W5D4	0.0	737	765	0.517	0.507	POMT2_DROME Protein O-mannosyl-transferase 2 OS=Drosophila melanogaster OX=7227 GN=tw PE=2 SV=1
5	G5EB59	1.25e-154	469	740	0.389	0.395	G5EB59_EMENI Dolichyl-phosphate-mannose--protein mannosyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05105 PE=3 SV=1
6	P31382	1.72e-146	448	759	0.361	0.357	PMT2_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT2 PE=1 SV=2
7	Q6FUT7	5.61e-139	428	734	0.359	0.366	Q6FUT7_CANGA Dolichyl-phosphate-mannose--protein mannosyltransferase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0F00759g PE=3 SV=1
8	Q4WWN0	5.08e-138	432	946	0.356	0.282	Q4WWN0_ASPFU Dolichyl-phosphate-mannose--protein mannosyltransferase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_3G06450 PE=3 SV=1
9	Q5ADM9	9.19e-136	421	769	0.340	0.332	PMT2_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT2 PE=1 SV=1
10	Q9C100	6.65e-134	415	739	0.339	0.344	PMT2_SCHPO Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm2 PE=3 SV=1
11	P47190	6.74e-134	416	753	0.331	0.329	PMT3_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT3 PE=1 SV=2
12	Q5A688	1.14e-123	391	832	0.335	0.302	PMT6_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT6 PE=2 SV=1
13	P42934	4.38e-122	385	759	0.333	0.329	PMT6_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT6 PE=1 SV=1
14	O74189	1.95e-114	368	877	0.325	0.278	PMT1_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT1 PE=2 SV=1
15	Q5BDC1	7.62e-111	356	773	0.313	0.304	Q5BDC1_EMENI Dolichyl-phosphate-mannose--protein mannosyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01459 PE=3 SV=1
16	P33775	6.42e-107	347	817	0.321	0.295	PMT1_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT1 PE=1 SV=1
17	Q4WCG5	1.01e-106	345	780	0.296	0.285	Q4WCG5_ASPFU Dolichyl-phosphate-mannose--protein mannosyltransferase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_8G04500 PE=3 SV=1
18	Q9Y6A1	3.33e-103	335	747	0.323	0.324	POMT1_HUMAN Protein O-mannosyl-transferase 1 OS=Homo sapiens OX=9606 GN=POMT1 PE=1 SV=3
19	F1QF89	4.00e-100	326	720	0.309	0.322	POMT1_DANRE Protein O-mannosyl-transferase 1 OS=Danio rerio OX=7955 GN=pomt1 PE=1 SV=1
20	Q99PR0	6.41e-100	326	747	0.327	0.328	POMT1_RAT Protein O-mannosyl-transferase 1 OS=Rattus norvegicus OX=10116 GN=Pomt1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02815 MIR	9.8e-19	79.4	MIR domain
2	PF02366 PMT	5.5e-87	303.0	Dolichyl-phosphate-mannose-protein mannosyltransferase
3	PF16192 PMT_4TMC	2.8e-49	179.0	C-terminal four TMM region of protein-O-mannosyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261534

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361060	0.995	Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1
2	9606.ENSP00000357384	0.989	Dolichol-phosphate mannosyltransferase subunit 3
3	9606.ENSP00000344125	0.988	Protein O-linked-mannose beta-1,4-N-acetylglucosaminyltransferase 2
4	9606.ENSP00000442600	0.986	Dystroglycan
5	9606.ENSP00000360644	0.985	Dolichol-phosphate mannosyltransferase subunit 1
6	9606.ENSP00000322181	0.981	Dolichol phosphate-mannose biosynthesis regulatory protein
7	9606.ENSP00000223528	0.950	Fukutin
8	9606.ENSP00000326570	0.911	Fukutin-related protein
9	9606.ENSP00000361302	0.905	Protein O-mannosyl-transferase 1
10	9606.ENSP00000361667	0.895	Dolichol kinase
11	9606.ENSP00000261234	0.885	UDP-D-xylose:ribitol-5-phosphate beta1,4-xylosyltransferase
12	9606.ENSP00000331258	0.883	Protein O-mannose kinase
13	9606.ENSP00000385478	0.874	D-ribitol-5-phosphate cytidylyltransferase
14	9606.ENSP00000309092	0.848	Mannose-1-phosphate guanyltransferase beta
15	9606.ENSP00000355559	0.846	UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 2
16	9606.ENSP00000432869	0.785	LARGE xylosyl- and glucuronyltransferase 2
17	9606.ENSP00000309096	0.776	Beta-1,4-glucuronyltransferase 1
18	9606.ENSP00000347088	0.750	LARGE xylosyl- and glucuronyltransferase 1
19	9606.ENSP00000298351	0.736	Calcium permeable stress-gated cation channel 1
20	9606.ENSP00000298352	0.732	Neuroglobin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000030	1.000	mannosyltransferase activity
GO:0005515	0.987	protein binding
GO:0004169	0.964	dolichyl-phosphate-mannose-protein mannosyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1901576	0.996	organic substance biosynthetic process
GO:0044249	0.996	cellular biosynthetic process
GO:0044260	0.996	cellular macromolecule metabolic process
GO:0019538	0.996	protein metabolic process
GO:1901135	0.995	carbohydrate derivative metabolic process
GO:0006486	0.989	protein glycosylation
GO:0006493	0.971	protein O-linked glycosylation
GO:0035268	0.957	protein mannosylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	0.999	endoplasmic reticulum membrane
GO:0070013	0.984	intracellular organelle lumen
GO:0005829	0.969	cytosol
GO:0005634	0.964	nucleus
GO:0031981	0.947	nuclear lumen
GO:0005654	0.938	nucleoplasm
GO:0043232	0.915	intracellular non-membrane-bounded organelle
GO:0032991	0.356	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.
EC:2.4.1.109	0.964	dolichyl-phosphate-mannose--protein mannosyltransferase.

[back to server]