StarFunc result for job id Q9UKZ1

User Input

>input (510 residues)
MPGGGASAASGRLLTAAEQRGSREAAGSASRSGFGGSGGGRGGASGPGSGSGGPGGPAGR
MSLTPKELSSLLSIISEEAGGGSTFEGLSTAFHHYFSKADHFRLGSVLVMLLQQPDLLPS
AAQRLTALYLLWEMYRTEPLAANPFAASFAHLLNPAPPARGGQEPDRPPLSGFLPPITPP
EKFFLSQLMLAPPRELFKKTPRQIALMDVGNMGQSVDISGLQLALAERQSELPTQSKASF
PSILSDPDPDSSNSGFDSSVASQITEALVSGPKPPIESHFRPEFIRPPPPLHICEDELAW
LNPTEPDHAIQWDKSMCVKNSTGVEIKRIMAKAFKSPLSSPQQTQLLGELEKDPKLVYHI
GLTPAKLPDLVENNPLVAIEMLLKLMQSSQITEYFSVLVNMDMSLHSMEVVNRLTTAVDL
PPEFIHLYISNCISTCEQIKDKYMQNRLVRLVCVFLQSLIRNKIINVQDLFIEVQAFCIE
FSRIREAAGLFRLLKTLDTGETPSETKMSK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UKZ1	1.000	1.000	1.962E-65	510	1.000	1.000	Q9UKZ1.pdb.gz	CNO11_HUMAN CCR4-NOT transcription complex subunit 11 OS=Homo sapiens OX=9606 GN=CNOT11 PE=1 SV=1
2	AFDB:Q9W1C6	0.346	0.766	3.054E-15	227	0.259	0.581	Q9W1C6.pdb.gz	Q9W1C6_DROME CCR4-NOT transcription complex subunit 11 OS=Drosophila melanogaster OX=7227 GN=Not11 PE=1 SV=3
3	AFDB:Q8MLP8	0.360	0.730	5.255E-15	247	0.261	0.538	Q8MLP8.pdb.gz	Q8MLP8_DROME CCR4-NOT transcription complex subunit 11 OS=Drosophila melanogaster OX=7227 GN=Not11 PE=1 SV=1
4	AFDB:Q581Y6	0.305	0.356	3.435E-7	434	0.151	0.177	Q581Y6.pdb.gz	Q581Y6_TRYB2 CCR4-NOT transcription complex subunit 11 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26N11.430 PE=3 SV=1
5	AFDB:Q8W4Q4	0.151	0.116	5.731E-2	702	0.137	0.100	Q8W4Q4.pdb.gz	MRF3_ARATH MA3 DOMAIN-CONTAINING TRANSLATION REGULATORY FACTOR 3 OS=Arabidopsis thaliana OX=3702 GN=MRF3 PE=1 SV=1
6	PDB:6n1zA	0.197	0.118	7.266E-2	961	0.106	0.056	6n1zA.pdb.gz
7	PDB:7dvqV	0.150	0.160	9.732E-2	468	0.086	0.094	7dvqV.pdb.gz	Structure of the activated human minor spliceosome.
8	AFDB:D3DQV9	0.152	0.095	1.165E-1	907	0.135	0.076	D3DQV9.pdb.gz	D3DQV9_HUMAN Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2 PE=1 SV=1
9	AFDB:Q10451	0.108	0.065	1.215E-1	1261	0.143	0.058	Q10451.pdb.gz	PPR5_SCHPO Pentatricopeptide repeat-containing protein 5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppr5 PE=4 SV=2
10	AFDB:Q24151	0.071	0.054	1.627E-1	761	0.088	0.059	Q24151.pdb.gz	STAT_DROME Signal transducer and transcription activator OS=Drosophila melanogaster OX=7227 GN=Stat92E PE=1 SV=1
11	AFDB:Q9ZW06	0.164	0.103	2.005E-1	972	0.096	0.050	Q9ZW06.pdb.gz	PUM2_ARATH Pumilio homolog 2 OS=Arabidopsis thaliana OX=3702 GN=APUM2 PE=1 SV=1
12	PDB:7qenD	0.141	0.084	2.339E-1	1050	0.122	0.059	7qenD.pdb.gz	A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.
13	PDB:7qpgR	0.145	0.047	2.339E-1	2208	0.106	0.024	7qpgR.pdb.gz
14	PDB:1wa5B	0.211	0.226	2.543E-1	466	0.102	0.112	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
15	AFDB:F1R9I0	0.236	0.150	2.576E-1	891	0.067	0.038	F1R9I0.pdb.gz
16	PDB:3qouA	0.110	0.177	3.551E-1	282	0.047	0.085	3qouA.pdb.gz	Escherichia coli Thioredoxin-like Protein YbbN Contains an Atypical Tetratricopeptide Repeat Motif and Is a Negative Regulator of GroEL.
17	PDB:7jq9A	0.156	0.045	3.551E-1	2427	0.090	0.019	7jq9A.pdb.gz
18	PDB:7mp5A	0.131	0.056	3.860E-1	1629	0.106	0.033	7mp5A.pdb.gz
19	PDB:1h2uA	0.143	0.112	4.562E-1	706	0.108	0.078	1h2uA.pdb.gz	Large-Scale Induced Fit Recognition of an M(7)Gpppg CAP Analogue by the Human Nuclear CAP-Binding Complex
20	PDB:7kzqE	0.155	0.180	4.756E-1	419	0.108	0.131	7kzqE.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UKZ1	0.0	1036	510	1.000	1.000	CNO11_HUMAN CCR4-NOT transcription complex subunit 11 OS=Homo sapiens OX=9606 GN=CNOT11 PE=1 SV=1
2	Q9W1C6	4.06e-85	264	227	0.263	0.590	Q9W1C6_DROME CCR4-NOT transcription complex subunit 11 OS=Drosophila melanogaster OX=7227 GN=Not11 PE=1 SV=3
3	Q8MLP8	2.89e-81	254	247	0.265	0.547	Q8MLP8_DROME CCR4-NOT transcription complex subunit 11 OS=Drosophila melanogaster OX=7227 GN=Not11 PE=1 SV=1
4	Q54K81	1.6	34.3	2614	0.039	0.008	TALB_DICDI Talin-B OS=Dictyostelium discoideum OX=44689 GN=talB PE=2 SV=1
5	Q8I0P7	3.1	33.1	678	0.039	0.029	PDE3_CAEEL Probable 3',5'-cyclic phosphodiesterase pde-3 OS=Caenorhabditis elegans OX=6239 GN=pde-3 PE=3 SV=4
6	F1QM29	5.5	32.3	1413	0.049	0.018	F1QM29_DANRE Retinitis pigmentosa GTPase regulator b OS=Danio rerio OX=7955 GN=rpgrb PE=4 SV=1
7	Q9LXX6	7.6	32.0	790	0.051	0.033	SC15A_ARATH Exocyst complex component SEC15A OS=Arabidopsis thaliana OX=3702 GN=SEC15A PE=3 SV=2
8	Q04748	8.0	31.6	898	0.063	0.036	SOV1_YEAST Protein SOV1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SOV1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10155 CNOT11	5.7e-50	180.1	CCR4-NOT transcription complex subunit 11

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000289382

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000320949	0.999	CCR4-NOT transcription complex subunit 1
2	9606.ENSP00000399862	0.999	CCR4-NOT transcription complex subunit 10
3	9606.ENSP00000229195	0.998	CCR4-NOT transcription complex subunit 2
4	9606.ENSP00000355279	0.997	CCR4-NOT transcription complex subunit 7
5	9606.ENSP00000273064	0.996	CCR4-NOT transcription complex subunit 9
6	9606.ENSP00000351159	0.993	CCR4-NOT transcription complex subunit 3
7	9606.ENSP00000424896	0.992	CCR4-NOT transcription complex subunit 6-like
8	9606.ENSP00000377024	0.990	CCR4-NOT transcription complex subunit 6
9	9606.ENSP00000437271	0.988	182 kDa tankyrase-1-binding protein
10	9606.ENSP00000430493	0.986	CCR4-NOT transcription complex subunit 8
11	9606.ENSP00000427695	0.964	Protein Tob1
12	9606.ENSP00000445508	0.960	CCR4-NOT transcription complex subunit 4
13	9606.ENSP00000269349	0.916	Eukaryotic initiation factor 4A-III
14	9606.ENSP00000313007	0.913	Polyadenylate-binding protein 1
15	9606.ENSP00000482128	0.911	Cytoplasmic polyadenylation element-binding protein 3
16	9606.ENSP00000416255	0.908	Eukaryotic translation initiation factor 4 gamma 1
17	9606.ENSP00000302768	0.903	Polyadenylate-binding protein-interacting protein 1
18	9606.ENSP00000293831	0.902	Eukaryotic initiation factor 4A-I
19	9606.ENSP00000425561	0.902	Eukaryotic translation initiation factor 4E
20	9606.ENSP00000326381	0.901	Eukaryotic initiation factor 4A-II

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0008152	0.992	metabolic process
GO:0050794	0.992	regulation of cellular process
GO:0048519	0.988	negative regulation of biological process
GO:0009987	0.980	cellular process
GO:0031323	0.979	regulation of cellular metabolic process
GO:0051171	0.978	regulation of nitrogen compound metabolic process
GO:0080090	0.977	regulation of primary metabolic process
GO:0043170	0.975	macromolecule metabolic process
GO:0010468	0.975	regulation of gene expression
GO:0044238	0.974	primary metabolic process
GO:0031324	0.973	negative regulation of cellular metabolic process
GO:0051172	0.972	negative regulation of nitrogen compound metabolic process
GO:0006807	0.971	nitrogen compound metabolic process
GO:0031326	0.971	regulation of cellular biosynthetic process
GO:0010605	0.971	negative regulation of macromolecule metabolic process
GO:0010556	0.969	regulation of macromolecule biosynthetic process
GO:0044237	0.956	cellular metabolic process
GO:0010608	0.956	post-transcriptional regulation of gene expression
GO:0051246	0.955	regulation of protein metabolic process
GO:0006139	0.946	nucleobase-containing compound metabolic process
GO:0090304	0.941	nucleic acid metabolic process
GO:0010558	0.882	negative regulation of macromolecule biosynthetic process
GO:0016070	0.876	RNA metabolic process
GO:2000112	0.874	regulation of cellular macromolecule biosynthetic process
GO:0031327	0.859	negative regulation of cellular biosynthetic process
GO:0044260	0.847	cellular macromolecule metabolic process
GO:0010629	0.835	negative regulation of gene expression
GO:0051248	0.824	negative regulation of protein metabolic process
GO:0009056	0.729	catabolic process
GO:0034248	0.713	regulation of amide metabolic process
GO:0006417	0.686	regulation of translation
GO:0048522	0.680	positive regulation of cellular process
GO:0044248	0.574	cellular catabolic process
GO:0019219	0.530	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.481	regulation of RNA metabolic process
GO:0034249	0.479	negative regulation of amide metabolic process
GO:0016071	0.463	mRNA metabolic process
GO:1901575	0.440	organic substance catabolic process
GO:0017148	0.411	negative regulation of translation
GO:0044265	0.390	cellular macromolecule catabolic process
GO:0009893	0.372	positive regulation of metabolic process
GO:0034655	0.367	nucleobase-containing compound catabolic process
GO:0006402	0.356	mRNA catabolic process
GO:0010604	0.340	positive regulation of macromolecule metabolic process
GO:0031325	0.340	positive regulation of cellular metabolic process
GO:0051173	0.326	positive regulation of nitrogen compound metabolic process
GO:0009894	0.300	regulation of catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0030014	0.999	CCR4-NOT complex
GO:0043226	0.934	organelle
GO:0043229	0.920	intracellular organelle
GO:0043231	0.796	intracellular membrane-bounded organelle
GO:0005634	0.700	nucleus
GO:0016020	0.462	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]