StarFunc result for job id Q9UKZ4

User Input

>input (1400 residues)
MEQTDCKPYQPLPKVKHEMDLAYTSSSDESEDGRKPRQSYNSRETLHEYNQELRMNYNSQ
SRKRKEVEKSTQEMEFCETSHTLCSGYQTDMHSVSRHGYQLEMGSDVDTETEGAASPDHA
LRMWIRGMKSEHSSCLSSRANSALSLTDTDHERKSDGENGFKFSPVCCDMEAQAGSTQDV
QSSPHNQFTFRPLPPPPPPPHACTCARKPPPAADSLQRRSMTTRSQPSPAAPAPPTSTQD
SVHLHNSWVLNSNIPLETRHFLFKHGSGSSAIFSAASQNYPLTSNTVYSPPPRPLPRSTF
SRPAFTFNKPYRCCNWKCTALSATAITVTLALLLAYVIAVHLFGLTWQLQPVEGELYANG
VSKGNRGTESMDTTYSPIGGKVSDKSEKKVFQKGRAIDTGEVDIGAQVMQTIPPGLFWRF
QITIHHPIYLKFNISLAKDSLLGIYGRRNIPPTHTQFDFVKLMDGKQLVKQDSKGSDDTQ
HSPRNLILTSLQETGFIEYMDQGPWYLAFYNDGKKMEQVFVLTTAIEIMDDCSTNCNGNG
ECISGHCHCFPGFLGPDCARDSCPVLCGGNGEYEKGHCVCRHGWKGPECDVPEEQCIDPT
CFGHGTCIMGVCICVPGYKGEICEEEDCLDPMCSNHGICVKGECHCSTGWGGVNCETPLP
VCQEQCSGHGTFLLDAGVCSCDPKWTGSDCSTELCTMECGSHGVCSRGICQCEEGWVGPT
CEERSCHSHCTEHGQCKDGKCECSPGWEGDHCTIAHYLDAVRDGCPGLCFGNGRCTLDQN
GWHCVCQVGWSGTGCNVVMEMLCGDNLDNDGDGLTDCVDPDCCQQSNCYISPLCQGSPDP
LDLIQQSQTLFSQHTSRLFYDRIKFLIGKDSTHVIPPEVSFDSRRACVIRGQVVAIDGTP
LVGVNVSFLHHSDYGFTISRQDGSFDLVAIGGISVILIFDRSPFLPEKRTLWLPWNQFIV
VEKVTMQRVVSDPPSCDISNFISPNPIVLPSPLTSFGGSCPERGTIVPELQVVQEEIPIP
SSFVRLSYLSSRTPGYKTLLRILLTHSTIPVGMIKVHLTVAVEGRLTQKWFPAAINLVYT
FAWNKTDIYGQKVWGLAEALVSVGYEYETCPDFILWEQRTVVLQGFEMDASNLGGWSLNK
HHILNPQSGIIHKGNGENMFISQQPPVISTIMGNGHQRSVACTNCNGPAHNNKLFAPVAL
ASGPDGSVYVGDFNFVRRIFPSGNSVSILELSTSPAHKYYLAMDPVSESLYLSDTNTRKV
YKLKSLVETKDLSKNFEVVAGTGDQCLPFDQSHCGDGGRASEASLNSPRGITVDRHGFIY
FVDGTMIRKIDENAVITTVIGSNGLTSTQPLSCDSGMDITQVRLEWPTDLAVNPMDNSLY
VLDNNIVLQISENRRVRIIA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P273	0.527	0.288	0.000	2699	0.571	0.296	Q9P273.pdb.gz	TEN3_HUMAN Teneurin-3 OS=Homo sapiens OX=9606 GN=TENM3 PE=1 SV=3
2	PDB:5es4B	0.053	0.095	2.316E-8	674	0.038	0.079	5es4B.pdb.gz	Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
3	PDB:4g1eB	0.051	0.088	1.682E-7	709	0.039	0.078	4g1eB.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
4	AFDB:Q9U489	0.127	0.152	2.954E-6	1147	0.134	0.163	Q9U489.pdb.gz	LIN41_CAEEL Protein lin-41 OS=Caenorhabditis elegans OX=6239 GN=lin-41 PE=1 SV=1
5	PDB:1nr0A	0.076	0.154	4.187E-6	610	0.051	0.118	1nr0A.pdb.gz
6	PDB:7mq8LO	0.094	0.147	5.775E-6	848	0.040	0.066	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
7	PDB:7mqaLO	0.092	0.148	6.093E-6	819	0.044	0.076	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
8	PDB:3elqB	0.111	0.239	1.686E-5	566	0.038	0.094	3elqB.pdb.gz	A structural and biochemical basis for PAPS-independent sulfuryl transfer by aryl sulfotransferase from uropathogenic Escherichia coli.
9	PDB:3fm0A	0.102	0.360	5.783E-5	328	0.028	0.119	3fm0A.pdb.gz
10	AFDB:B7YZW3	0.047	0.034	6.609E-5	2064	0.135	0.092	B7YZW3.pdb.gz	B7YZW3_DROME Miles to go, isoform E OS=Drosophila melanogaster OX=7227 GN=mtgo PE=1 SV=1
11	PDB:5c2vB	0.101	0.358	9.367E-5	352	0.025	0.099	5c2vB.pdb.gz	The inner workings of the hydrazine synthase multiprotein complex.
12	PDB:7wb4j	0.087	0.116	9.882E-5	995	0.026	0.037	7wb4j.pdb.gz
13	PDB:2nsmA	0.056	0.193	1.517E-4	390	0.009	0.031	2nsmA.pdb.gz
14	AFDB:Q4ZJM7	0.056	0.143	1.401E-3	482	0.039	0.114	Q4ZJM7.pdb.gz	OTOL1_MOUSE Otolin-1 OS=Mus musculus OX=10090 GN=Otol1 PE=1 SV=2
15	AFDB:B7Z0K1	0.052	0.062	2.812E-3	1137	0.103	0.127	B7Z0K1.pdb.gz	B7Z0K1_DROME Bitesize, isoform H OS=Drosophila melanogaster OX=7227 GN=btsz PE=4 SV=1
16	AFDB:Q54NE5	0.049	0.038	5.349E-3	1918	0.093	0.068	Q54NE5.pdb.gz	Q54NE5_DICDI Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0285313 PE=4 SV=1
17	AFDB:Q03692	0.051	0.095	7.378E-3	680	0.051	0.104	Q03692.pdb.gz	COAA1_HUMAN Collagen alpha-1(X) chain OS=Homo sapiens OX=9606 GN=COL10A1 PE=1 SV=2
18	AFDB:Q9ULI3	0.036	0.036	1.935E-2	1381	0.084	0.085	Q9ULI3.pdb.gz	HEG1_HUMAN Protein HEG homolog 1 OS=Homo sapiens OX=9606 GN=HEG1 PE=1 SV=3
19	AFDB:E9Q4Y4	0.063	0.043	2.154E-2	2514	0.092	0.051	E9Q4Y4.pdb.gz	E9Q4Y4_MOUSE Centrosomal protein 192 OS=Mus musculus OX=10090 GN=Cep192 PE=1 SV=1
20	AFDB:Q8TEP8	0.053	0.033	2.971E-2	2537	0.114	0.063	Q8TEP8.pdb.gz	CE192_HUMAN Centrosomal protein of 192 kDa OS=Homo sapiens OX=9606 GN=CEP192 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O61307	0.0	830	2731	0.289	0.148	TENM_DROME Teneurin-m OS=Drosophila melanogaster OX=7227 GN=Ten-m PE=1 SV=2
2	Q3UHK6	0.0	1659	2771	0.601	0.304	TEN4_MOUSE Teneurin-4 OS=Mus musculus OX=10090 GN=Tenm4 PE=1 SV=2
3	Q6N022	0.0	1698	2769	0.600	0.303	TEN4_HUMAN Teneurin-4 OS=Homo sapiens OX=9606 GN=TENM4 PE=1 SV=2
4	Q9DER5	0.0	1576	2802	0.576	0.288	TEN2_CHICK Teneurin-2 OS=Gallus gallus OX=9031 GN=TENM2 PE=1 SV=1
5	Q9NT68	0.0	1616	2774	0.581	0.293	TEN2_HUMAN Teneurin-2 OS=Homo sapiens OX=9606 GN=TENM2 PE=1 SV=3
6	Q9P273	0.0	1662	2699	0.576	0.299	TEN3_HUMAN Teneurin-3 OS=Homo sapiens OX=9606 GN=TENM3 PE=1 SV=3
7	Q9R1K2	0.0	1598	2774	0.575	0.290	TEN2_RAT Teneurin-2 OS=Rattus norvegicus OX=10116 GN=Tenm2 PE=1 SV=2
8	Q9UKZ4	0.0	2952	2725	1.000	0.514	TEN1_HUMAN Teneurin-1 OS=Homo sapiens OX=9606 GN=TENM1 PE=1 SV=2
9	Q9VYN8	0.0	760	3004	0.271	0.126	TENA_DROME Teneurin-a OS=Drosophila melanogaster OX=7227 GN=Ten-a PE=1 SV=2
10	Q9W6V6	0.0	2564	2705	0.871	0.451	TEN1_CHICK Teneurin-1 OS=Gallus gallus OX=9031 GN=TENM1 PE=1 SV=1
11	Q9W7R3	0.0	1706	2824	0.597	0.296	TEN4_DANRE Teneurin-4 OS=Danio rerio OX=7955 GN=tenm4 PE=2 SV=1
12	Q9W7R4	0.0	1562	2694	0.531	0.276	TEN3_DANRE Teneurin-3 OS=Danio rerio OX=7955 GN=tenm3 PE=2 SV=2
13	Q9WTS4	0.0	2781	2731	0.964	0.494	TEN1_MOUSE Teneurin-1 OS=Mus musculus OX=10090 GN=Tenm1 PE=1 SV=1
14	Q9WTS5	0.0	1602	2764	0.576	0.292	TEN2_MOUSE Teneurin-2 OS=Mus musculus OX=10090 GN=Tenm2 PE=1 SV=1
15	Q9WTS6	0.0	1670	2715	0.576	0.297	TEN3_MOUSE Teneurin-3 OS=Mus musculus OX=10090 GN=Tenm3 PE=1 SV=1
16	H1ZUX0	1.92e-151	512	2837	0.243	0.120	H1ZUX0_CAEEL EGF-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ten-1 PE=1 SV=1
17	H1ZUX1	2.82e-151	512	2763	0.243	0.123	H1ZUX1_CAEEL EGF-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ten-1 PE=1 SV=1
18	G5EGQ6	4.18e-151	511	2684	0.243	0.127	TEN1_CAEEL Teneurin-1 OS=Caenorhabditis elegans OX=6239 GN=ten-1 PE=1 SV=1
19	A0A5F8MPH8	3.48e-47	189	4356	0.074	0.024	A0A5F8MPH8_MOUSE Tenascin XB OS=Mus musculus OX=10090 GN=Tnxb PE=1 SV=1
20	A0A571BG59	3.83e-47	189	4114	0.074	0.025	A0A571BG59_MOUSE Tenascin XB OS=Mus musculus OX=10090 GN=Tnxb PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13620 CarboxypepD_reg	2.4e+02	13.4	Carboxypeptidase regulatory-like domain
2	PF07974 EGF_2	4.5e-20	83.0	EGF-like domain
3	PF18372 I-EGF_1	14	17.0	Integrin beta epidermal growth factor like domain 1
4	PF01436 NHL	3	19.2	NHL repeat
5	PF06739 SBBP	1.4e+02	13.8	Beta-propeller repeat
6	PF06484 Ten_N	8.3e-73	257.8	Teneurin Intracellular Region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000403954

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340688	0.865	Adhesion G protein-coupled receptor L1
2	9606.ENSP00000360293	0.809	Sorbin and SH3 domain-containing protein 1
3	9606.ENSP00000422533	0.798	Adhesion G protein-coupled receptor L3
4	9606.ENSP00000322270	0.720	Adhesion G protein-coupled receptor L2
5	9606.ENSP00000373272	0.653	E3 ubiquitin-protein ligase TRIM71
6	9606.ENSP00000390475	0.645	CXXC-type zinc finger protein 1
7	9606.ENSP00000443410	0.632	Putative nucleotidyltransferase FAM46D
8	9606.ENSP00000377699	0.629	Adhesion G-protein coupled receptor G4
9	9606.ENSP00000343818	0.568	CDK5 regulatory subunit-associated protein 2
10	9606.ENSP00000262894	0.563	Zinc finger protein 225
11	9606.ENSP00000332756	0.560	Phospholipid-transporting ATPase IG
12	9606.ENSP00000361036	0.559	LHFPL tetraspan subfamily member 1
13	9606.ENSP00000362372	0.559	Bromodomain and WD repeat-containing protein 3
14	9606.ENSP00000417914	0.559	Ankyrin repeat and SOCS box protein 11
15	9606.ENSP00000360167	0.551	DDB1- and CUL4-associated factor 12-like protein 1
16	9606.ENSP00000468785	0.536	Methyl-CpG-binding domain protein 1
17	9606.ENSP00000304229	0.520	Histidine triad nucleotide-binding protein 1
18	9606.ENSP00000335083	0.518	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform
19	9606.ENSP00000359778	0.511	Adhesion G protein-coupled receptor L4
20	9606.ENSP00000408292	0.507	E3 ubiquitin-protein ligase TRIM32

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0046983	0.451	protein dimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.976	regulation of cellular process
GO:0009987	0.956	cellular process
GO:0007399	0.721	nervous system development
GO:0050896	0.701	response to stimulus
GO:0048518	0.650	positive regulation of biological process
GO:0051128	0.618	regulation of cellular component organization
GO:0048522	0.605	positive regulation of cellular process
GO:0048519	0.593	negative regulation of biological process
GO:0048523	0.583	negative regulation of cellular process
GO:0042127	0.571	regulation of cell population proliferation
GO:0002376	0.519	immune system process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0071944	0.991	cell periphery
GO:0005886	0.983	plasma membrane
GO:0005622	0.891	intracellular anatomical structure
GO:0043226	0.821	organelle
GO:0005576	0.729	extracellular region
GO:0043229	0.726	intracellular organelle
GO:0005634	0.716	nucleus
GO:0005737	0.430	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]