StarFunc result for job id Q9UL01

User Input

>input (958 residues)
MRTHTRGAPSVFFIYLLCFVSAYITDENPEVMIPFTNANYDSHPMLYFSRAEVAELQLRA
ASSHEHIAARLTEAVHTMLSSPLEYLPPWDPKDYSARWNEIFGNNLGALAMFCVLYPENI
EARDMAKDYMERMAAQPSWLVKDAPWDEVPLAHSLVGFATAYDFLYNYLSKTQQEKFLEV
IANASGYMYETSYRRGWGFQYLHNHQPTNCMALLTGSLVLMNQGYLQEAYLWTKQVLTIM
EKSLVLLREVTDGSLYEGVAYGSYTTRSLFQYMFLVQRHFNINHFGHPWLKQHFAFMYRT
ILPGFQRTVAIADSNYNWFYGPESQLVFLDKFVMRNGSGNWLADQIRRNRVVEGPGTPSK
GQRWCTLHTEFLWYDGSLKSVPPPDFGTPTLHYFEDWGVVTYGSALPAEINRSFLSFKSG
KLGGRAIYDIVHRNKYKDWIKGWRNFNAGHEHPDQNSFTFAPNGVPFITEALYGPKYTFF
NNVLMFSPAVSKSCFSPWVGQVTEDCSSKWSKYKHDLAASCQGRVVAAEEKNGVVFIRGE
GVGAYNPQLNLKNVQRNLILLHPQLLLLVDQIHLGEESPLETAASFFHNVDVPFEETVVD
GVHGAFIRQRDGLYKMYWMDDTGYSEKATFASVTYPRGYPYNGTNYVNVTMHLRSPITRA
AYLFIGPSIDVQSFTVHGDSQQLDVFIATSKHAYATYLWTGEATGQSAFAQVIADRHKIL
FDRNSAIKSSIVPEVKDYAAIVEQNLQHFKPVFQLLEKQILSRVRNTASFRKTAERLLRF
SDKRQTEEAIDRIFAISQQQQQQSKSKKNRRAGKRYKFVDAVPDIFAQIEVNEKKIRQKA
QILAQKELPIDEDEEMKDLLDFADVTYEKHKNGGLIKGRFGQARMVTTTHSRAPSLSASY
TRLFLILNIAIFFVMLAMQLTYFQRAQSLHGQRCLYAVLLIDSCILLWLYSSCSQSQC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0C2H4	0.906	0.906	0.000	958	0.951	0.951	P0C2H4.pdb.gz	DSE_BOVIN Dermatan-sulfate epimerase OS=Bos taurus OX=9913 GN=DSE PE=1 SV=1
2	AFDB:Q8IZU8	0.698	0.553	1.101E-70	1212	0.372	0.294	Q8IZU8.pdb.gz	DSEL_HUMAN Dermatan-sulfate epimerase-like protein OS=Homo sapiens OX=9606 GN=DSEL PE=2 SV=2
3	AFDB:Q0VBN2	0.699	0.556	2.519E-69	1207	0.371	0.294	Q0VBN2.pdb.gz	DSEL_MOUSE Dermatan-sulfate epimerase-like protein OS=Mus musculus OX=10090 GN=Dsel PE=2 SV=1
4	PDB:2fuqA	0.442	0.546	5.332E-17	747	0.100	0.129	2fuqA.pdb.gz	Crystal Structure of Heparinase II from Pedobacter heparinus and Its Complex with a Disaccharide Product.
5	PDB:4mmhA	0.372	0.520	2.399E-12	637	0.074	0.111	4mmhA.pdb.gz	Crystal Structure of Pedobacter heparinus Heparin Lyase Hep III with the Active Site in a Deep Cleft
6	PDB:2cirA	0.113	0.296	7.220E-3	288	0.034	0.115	2cirA.pdb.gz	Structure-based functional annotation: yeast ymr099c codes for a D-hexose-6-phosphate mutarotase.
7	PDB:3nreA	0.144	0.390	1.122E-2	291	0.025	0.082	3nreA.pdb.gz
8	PDB:6i7sG	0.097	0.103	2.272E-2	863	0.070	0.078	6i7sG.pdb.gz	The crystal structure of human microsomal triglyceride transfer protein.
9	PDB:5gw7B	0.108	0.132	3.233E-2	760	0.019	0.024	5gw7B.pdb.gz	Crystal structure of the enzyme-product complex reveals sugar ring distortion during catalysis by family 63 inverting alpha-glycosidase
10	PDB:4j5tA	0.116	0.139	5.024E-2	788	0.022	0.027	4j5tA.pdb.gz
11	PDB:7r5jW0	0.057	0.071	5.024E-2	735	0.073	0.095	7r5jW0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
12	AFDB:Q386G2	0.071	0.072	9.478E-2	798	0.066	0.079	Q386G2.pdb.gz	Q386G2_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0980 PE=4 SV=1
13	AFDB:F1QBV5	0.051	0.031	1.082E-1	1770	0.049	0.027	F1QBV5.pdb.gz	F1QBV5_DANRE Kinesin family member 1B OS=Danio rerio OX=7955 GN=unm_st43 PE=1 SV=1
14	PDB:7vqoA	0.123	0.104	1.161E-1	1180	0.063	0.051	7vqoA.pdb.gz	Structural mechanism of protein recognition by the FW domain of autophagy receptor Nbr1
15	PDB:2f2hA	0.054	0.064	2.457E-1	773	0.019	0.023	2f2hA.pdb.gz	Expanding the Thioglycoligase Strategy to the Synthesis of alpha-linked Thioglycosides Allows Structural Investigation of the Parent Enzyme/Substrate Complex
16	AFDB:A8J6X7	0.035	0.047	2.731E-1	645	0.039	0.057	A8J6X7.pdb.gz	PCDP1_CHLRE Cilia- and flagella-associated protein 221 homolog OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP221 PE=1 SV=1
17	AFDB:Q6PF05	0.104	0.212	4.844E-1	361	0.048	0.127	Q6PF05.pdb.gz	TT23L_HUMAN Tetratricopeptide repeat protein 23-like OS=Homo sapiens OX=9606 GN=TTC23L PE=1 SV=2
18	AFDB:C9JFV4	0.094	0.081	7.204E-1	1180	0.037	0.030	C9JFV4.pdb.gz	C9JFV4_HUMAN Proline-, glutamic acid- and leucine-rich protein 1 OS=Homo sapiens OX=9606 GN=PELP1 PE=1 SV=2
19	AFDB:O62535	0.047	0.058	9.386E-1	712	0.053	0.072	O62535.pdb.gz	O62535_DROME Optomotor-blind-related gene-1 protein OS=Drosophila melanogaster OX=7227 GN=org-1 PE=2 SV=1
20	AFDB:P48423	0.078	0.070	9.386E-1	1163	0.097	0.080	P48423.pdb.gz	GAP1_DROME GTPase-activating protein OS=Drosophila melanogaster OX=7227 GN=RasGAP1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0C2H4	0.0	1875	958	0.951	0.951	DSE_BOVIN Dermatan-sulfate epimerase OS=Bos taurus OX=9913 GN=DSE PE=1 SV=1
2	Q0VBN2	0.0	660	1207	0.344	0.273	DSEL_MOUSE Dermatan-sulfate epimerase-like protein OS=Mus musculus OX=10090 GN=Dsel PE=2 SV=1
3	Q8IZU8	0.0	659	1212	0.340	0.269	DSEL_HUMAN Dermatan-sulfate epimerase-like protein OS=Homo sapiens OX=9606 GN=DSEL PE=2 SV=2
4	Q9UL01	0.0	2014	958	1.000	1.000	DSE_HUMAN Dermatan-sulfate epimerase OS=Homo sapiens OX=9606 GN=DSE PE=1 SV=1
5	Q9HZE0	0.29	37.7	1620	0.064	0.038	DHE2_PSEAE NAD-specific glutamate dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=gdhB PE=1 SV=1
6	Q9CY57	1.7	34.3	249	0.022	0.084	CHTOP_MOUSE Chromatin target of PRMT1 protein OS=Mus musculus OX=10090 GN=Chtop PE=1 SV=2
7	Q387W9	3.1	33.5	285	0.031	0.105	Q387W9_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.0940 PE=4 SV=1
8	Q9SRV7	5.6	32.7	306	0.025	0.078	SY131_ARATH Putative syntaxin-131 OS=Arabidopsis thaliana OX=3702 GN=SYP131 PE=3 SV=1
9	O18415	8.0	32.7	1116	0.013	0.011	O18415_DROME Nuclear protein SA OS=Drosophila melanogaster OX=7227 GN=SA1 PE=2 SV=1
10	Q9VM62	8.0	32.7	1127	0.013	0.011	Q9VM62_DROME LD34181p OS=Drosophila melanogaster OX=7227 GN=SA1 PE=1 SV=2
11	Q18406	9.2	32.3	659	0.022	0.032	EXOC5_CAEEL Exocyst complex component 5 OS=Caenorhabditis elegans OX=6239 GN=sec-10 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16332 DUF4962	0.0015	28.8	Domain of unknown function (DUF4962)
2	PF07940 Hepar_II_III	71	14.4	Heparinase II/III-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000332151

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307297	0.989	Carbohydrate sulfotransferase 14
2	9606.ENSP00000356433	0.970	Uronyl 2-sulfotransferase
3	9606.ENSP00000402394	0.966	Carbohydrate sulfotransferase 15
4	9606.ENSP00000052754	0.954	Decorin
5	9606.ENSP00000327336	0.945	Biglycan
6	9606.ENSP00000265077	0.930	Versican core protein
7	9606.ENSP00000312506	0.908	Chondroitin sulfate proteoglycan 4
8	9606.ENSP00000331210	0.907	Brevican core protein
9	9606.ENSP00000373244	0.902	Chondroitin sulfate proteoglycan 5
10	9606.ENSP00000252575	0.901	Neurocan core protein
11	9606.ENSP00000285879	0.811	Melanoma-associated antigen C1
12	9606.ENSP00000310448	0.765	U4/U6.U5 tri-snRNP-associated protein 1
13	9606.ENSP00000363809	0.727	Zinc transporter SLC39A7
14	9606.ENSP00000305725	0.711	Carbohydrate sulfotransferase 11
15	9606.ENSP00000228284	0.651	Squamous cell carcinoma antigen recognized by T-cells 3
16	9606.ENSP00000362207	0.628	Carbohydrate sulfotransferase 3
17	9606.ENSP00000481912	0.604	Carbohydrate sulfotransferase 12
18	9606.ENSP00000254190	0.595	Chondroitin sulfate synthase 1
19	9606.ENSP00000411816	0.582	Chondroitin sulfate N-acetylgalactosaminyltransferase 1
20	9606.ENSP00000317404	0.579	Carbohydrate sulfotransferase 13

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0047757	1.000	chondroitin-glucuronate 5-epimerase activity
GO:0005488	0.385	binding
GO:0005515	0.319	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0030166	0.986	proteoglycan biosynthetic process
GO:0044272	0.983	sulfur compound biosynthetic process
GO:0006024	0.971	glycosaminoglycan biosynthetic process
GO:0044283	0.954	small molecule biosynthetic process
GO:0016051	0.953	carbohydrate biosynthetic process
GO:1903510	0.949	mucopolysaccharide metabolic process
GO:0046394	0.938	carboxylic acid biosynthetic process
GO:0046364	0.935	monosaccharide biosynthetic process
GO:0072330	0.924	monocarboxylic acid biosynthetic process
GO:0050655	0.369	dermatan sulfate proteoglycan metabolic process
GO:0050651	0.359	dermatan sulfate proteoglycan biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	1.000	Golgi membrane
GO:0005783	0.994	endoplasmic reticulum
GO:0070013	0.369	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21084	1.000	chondroitin 4'-sulfate = dermatan 4'-sulfate
EC:5.1.3.19	1.000	chondroitin-glucuronate 5-epimerase.

[back to server]