StarFunc result for job id Q9UL12

User Input

>input (918 residues)
MASLSRALRVAAAHPRQSPTRGMGPCNLSSAAGPTAEKSVPYQRTLKEGQGTSVVAQGPS
RPLPSTANVVVIGGGSLGCQTLYHLAKLGMSGAVLLERERLTSGTTWHTAGLLWQLRPSD
VEVELLAHTRRVVSRELEEETGLHTGWIQNGGLFIASNRQRLDEYKRLMSLGKAYGVESH
VLSPAETKTLYPLMNVDDLYGTLYVPHDGTMDPAGTCTTLARAASARGAQVIENCPVTGI
RVWTDDFGVRRVAGVETQHGSIQTPCVVNCAGVWASAVGRMAGVKVPLVAMHHAYVVTER
IEGIQNMPNVRDHDASVYLRLQGDALSVGGYEANPIFWEEVSDKFAFGLFDLDWEVFTQH
IEGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGEAPELRGFFLGCGFNSAGMMLGGGC
GQELAHWIIHGRPEKDMHGYDIRRFHHSLTDHPRWIRERSHESYAKNYSVVFPHDEPLAG
RNMRRDPLHEELLGQGCVFQERHGWERPGWFHPRGPAPVLEYDYYGAYGSRAHEDYAYRR
LLADEYTFAFPPHHDTIKKECLACRGAAAVFDMSYFGKFYLVGLDARKAADWLFSADVSR
PPGSTVYTCMLNHRGGTESDLTVSRLAPSHQASPLAPAFEGDGYYLAMGGAVAQHNWSHI
TTVLQDQKSQCQLIDSSEDLGMISIQGPASRAILQEVLDADLSNEAFPFSTHKLLRAAGH
LVRAMRLSFVGELGWELHIPKASCVPVYRAVMAAGAKHGLINAGYRAIDSLSIEKGYRHW
HADLRPDDSPLEAGLAFTCKLKSPVPFLGREALEQQRAAGLRRRLVCFTMEDKVPMFGLE
AIWRNGQVVGHVRRADFGFAIDKTIAYGYIHDPSGGPVSLDFVKSGDYALERMGVTYGAQ
AHLKSPFDPNNKRVKGIY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q64380	0.981	0.980	0.000	919	0.886	0.885	Q64380.pdb.gz	SARDH_RAT Sarcosine dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Sardh PE=1 SV=2
2	AFDB:Q8IGS5	0.926	0.938	0.000	907	0.484	0.490	Q8IGS5.pdb.gz	Q8IGS5_DROME RE37361p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Sardh PE=2 SV=1
3	AFDB:Q9UL12	1.000	1.000	0.000	918	1.000	1.000	Q9UL12.pdb.gz	SARDH_HUMAN Sarcosine dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=SARDH PE=1 SV=1
4	AFDB:Q8NCN5	0.858	0.895	5.112E-88	879	0.301	0.314	Q8NCN5.pdb.gz	PDPR_HUMAN Pyruvate dehydrogenase phosphatase regulatory subunit, mitochondrial OS=Homo sapiens OX=9606 GN=PDPR PE=1 SV=2
5	AFDB:Q9UI17	0.832	0.881	9.397E-83	866	0.316	0.335	Q9UI17.pdb.gz	M2GD_HUMAN Dimethylglycine dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=DMGDH PE=1 SV=2
6	AFDB:Q9DBT9	0.835	0.881	6.066E-82	869	0.313	0.330	Q9DBT9.pdb.gz	M2GD_MOUSE Dimethylglycine dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Dmgdh PE=1 SV=1
7	PDB:4pabB	0.832	0.923	9.972E-81	824	0.300	0.334	4pabB.pdb.gz	Folate in demethylation: The crystal structure of the rat dimethylglycine dehydrogenase complexed with tetrahydrofolate.
8	AFDB:Q9UL10	0.281	0.647	5.292E-45	396	0.320	0.742	Q9UL10.pdb.gz	Q9UL10_HUMAN Sarcosine dehydrogenase OS=Homo sapiens OX=9606 GN=SARDH PE=1 SV=1
9	AFDB:Q9HTE6	0.391	0.358	2.263E-33	1005	0.150	0.137	Q9HTE6.pdb.gz	Q9HTE6_PSEAE Sarcosine oxidase alpha subunit OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=soxA PE=3 SV=1
10	AFDB:Q5JFG7	0.373	0.859	1.676E-29	386	0.101	0.241	Q5JFG7.pdb.gz	Q5JFG7_THEKO Sarcosine oxidase, beta subunit OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) OX=69014 GN=TK0117 PE=4 SV=1
11	AFDB:O65396	0.378	0.831	5.239E-29	408	0.090	0.203	O65396.pdb.gz	GCST_ARATH Aminomethyltransferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GDCST PE=2 SV=1
12	PDB:1wsvA	0.371	0.890	8.612E-28	371	0.100	0.248	1wsvA.pdb.gz	Crystal Structure of Human T-protein of Glycine Cleavage System at 2.0A Resolution and its Implication for Understanding Non-ketotic Hyperglycinemia
13	PDB:1vloA	0.354	0.859	2.251E-26	364	0.111	0.280	1vloA.pdb.gz
14	PDB:4yshA	0.356	0.830	1.983E-25	370	0.096	0.238	4yshA.pdb.gz	Crystal structure of glycine oxidase from Geobacillus kaustophilus
15	PDB:3nycA	0.347	0.795	1.756E-22	381	0.090	0.218	3nycA.pdb.gz	Conformational changes and substrate recognition in Pseudomonas aeruginosa D-arginine dehydrogenase.
16	PDB:3if9A	0.352	0.843	8.307E-22	364	0.086	0.217	3if9A.pdb.gz	Glyphosate resistance by engineering the flavoenzyme glycine oxidase.
17	PDB:2uzzB	0.361	0.850	2.749E-19	372	0.071	0.175	2uzzB.pdb.gz	The X-Ray Structure of N-Methyltryptophan Oxidase Reveals the Structural Determinants of Substrate Specificity.
18	PDB:3awiD	0.332	0.453	2.194E-16	659	0.062	0.086	3awiD.pdb.gz	Crystal structure of the bifunctional tRNA modification enzyme MnmC from Escherichia coli
19	PDB:5oc2A	0.339	0.648	6.184E-16	441	0.068	0.141	5oc2A.pdb.gz	Thermal stabilization of the deglycating enzyme Amadoriase I by rational design.
20	PDB:4yjdA	0.266	0.645	3.170E-14	342	0.062	0.167	4yjdA.pdb.gz	Crystal structure of DAAO variant

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1ZAZ2	0.0	912	894	0.486	0.499	A1ZAZ2_DROME Sarcosine dehydrogenase OS=Drosophila melanogaster OX=7227 GN=Sardh PE=1 SV=1
2	O96023	0.0	959	475	0.507	0.979	O96023_HUMAN Dimethylglycine dehydrogenase-like protein isoform 2 OS=Homo sapiens OX=9606 PE=2 SV=1
3	Q64380	0.0	1694	919	0.887	0.886	SARDH_RAT Sarcosine dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Sardh PE=1 SV=2
4	Q8IGS5	0.0	909	907	0.485	0.491	Q8IGS5_DROME RE37361p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Sardh PE=2 SV=1
5	Q961K2	0.0	619	600	0.325	0.497	Q961K2_DROME GH19226p OS=Drosophila melanogaster OX=7227 GN=Sardh PE=2 SV=1
6	Q99LB7	0.0	1703	919	0.887	0.886	SARDH_MOUSE Sarcosine dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Sardh PE=1 SV=1
7	Q9UL10	0.0	622	396	0.332	0.770	Q9UL10_HUMAN Sarcosine dehydrogenase OS=Homo sapiens OX=9606 GN=SARDH PE=1 SV=1
8	Q9UL11	0.0	605	328	0.322	0.902	Q9UL11_HUMAN Uncharacterized protein SARDH (Fragment) OS=Homo sapiens OX=9606 GN=SARDH PE=2 SV=1
9	Q9UL12	0.0	1901	918	1.000	1.000	SARDH_HUMAN Sarcosine dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=SARDH PE=1 SV=1
10	Q9UI17	5.45e-140	440	866	0.305	0.323	M2GD_HUMAN Dimethylglycine dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=DMGDH PE=1 SV=2
11	Q63342	6.31e-138	434	857	0.309	0.331	M2GD_RAT Dimethylglycine dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Dmgdh PE=1 SV=1
12	Q9DBT9	5.23e-136	430	869	0.303	0.320	M2GD_MOUSE Dimethylglycine dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Dmgdh PE=1 SV=1
13	Q8NCN5	1.58e-134	426	879	0.309	0.323	PDPR_HUMAN Pyruvate dehydrogenase phosphatase regulatory subunit, mitochondrial OS=Homo sapiens OX=9606 GN=PDPR PE=1 SV=2
14	Q7TSQ8	3.59e-128	409	878	0.313	0.327	PDPR_MOUSE Pyruvate dehydrogenase phosphatase regulatory subunit, mitochondrial OS=Mus musculus OX=10090 GN=Pdpr PE=1 SV=1
15	Q8TCC6	4.35e-90	300	613	0.216	0.323	Q8TCC6_HUMAN DMGDH protein (Fragment) OS=Homo sapiens OX=9606 GN=DMGDH PE=1 SV=1
16	Q5JFG7	3.50e-29	122	386	0.112	0.267	Q5JFG7_THEKO Sarcosine oxidase, beta subunit OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) OX=69014 GN=TK0117 PE=4 SV=1
17	Q9HTE6	4.63e-20	98.6	1005	0.112	0.102	Q9HTE6_PSEAE Sarcosine oxidase alpha subunit OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=soxA PE=3 SV=1
18	P49364	4.83e-19	92.8	408	0.090	0.203	GCST_PEA Aminomethyltransferase, mitochondrial OS=Pisum sativum OX=3888 GN=GDCST PE=1 SV=2
19	O65396	1.03e-18	92.0	408	0.088	0.199	GCST_ARATH Aminomethyltransferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GDCST PE=2 SV=1
20	P27248	4.76e-18	89.4	364	0.092	0.231	GCST_ECOLI Aminomethyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=gcvT PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01266 DAO	1.3e-59	214.3	FAD dependent oxidoreductase
2	PF16350 FAO_M	2.3e-16	71.1	FAD dependent oxidoreductase central domain
3	PF01571 GCV_T	6.3e-58	207.6	Aminomethyltransferase folate-binding domain
4	PF08669 GCV_T_C	6.9e-10	50.0	Glycine cleavage T-protein C-terminal barrel domain
5	PF07992 Pyr_redox_2	26	15.5	Pyridine nucleotide-disulphide oxidoreductase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360938

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000333667	0.983	Serine hydroxymethyltransferase, mitochondrial
2	9606.ENSP00000318868	0.982	Serine hydroxymethyltransferase, cytosolic
3	9606.ENSP00000370737	0.982	Glycine dehydrogenase (decarboxylating), mitochondrial
4	9606.ENSP00000361894	0.975	Glycine N-methyltransferase
5	9606.ENSP00000272771	0.969	Tomoregulin-2
6	9606.ENSP00000317721	0.952	Peroxisomal sarcosine oxidase
7	9606.ENSP00000228476	0.936	D-amino-acid oxidase
8	9606.ENSP00000231420	0.933	Alanine--glyoxylate aminotransferase 2, mitochondrial
9	9606.ENSP00000379895	0.927	Glycine amidinotransferase, mitochondrial
10	9606.ENSP00000255189	0.926	Dimethylglycine dehydrogenase, mitochondrial
11	9606.ENSP00000302620	0.923	Alanine-glyoxylate aminotransferase
12	9606.ENSP00000378416	0.918	5-aminolevulinate synthase, nonspecific, mitochondrial
13	9606.ENSP00000332369	0.911	5-aminolevulinate synthase, erythroid-specific, mitochondrial
14	9606.ENSP00000319531	0.776	Glycine cleavage system H protein, mitochondrial
15	9606.ENSP00000236959	0.768	Bifunctional purine biosynthesis protein PURH
16	9606.ENSP00000365777	0.750	Methylenetetrahydrofolate reductase
17	9606.ENSP00000258874	0.724	5-formyltetrahydrofolate cyclo-ligase
18	9606.ENSP00000274353	0.717	Betaine--homocysteine S-methyltransferase 1
19	9606.ENSP00000349856	0.704	Protein PRRC2B
20	9606.ENSP00000403536	0.687	Guanidinoacetate N-methyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046997	1.000	oxidoreductase activity, acting on the CH-NH group of donors, flavin as acceptor
GO:0050660	1.000	flavin adenine dinucleotide binding
GO:0005542	0.996	folic acid binding
GO:0008480	0.936	sarcosine dehydrogenase activity
GO:0005515	0.381	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.998	cellular metabolic process
GO:0071704	0.997	organic substance metabolic process
GO:0044281	0.996	small molecule metabolic process
GO:0006575	0.992	cellular modified amino acid metabolic process
GO:1901605	0.991	alpha-amino acid metabolic process
GO:1901360	0.979	organic cyclic compound metabolic process
GO:0046483	0.972	heterocycle metabolic process
GO:0006725	0.945	cellular aromatic compound metabolic process
GO:0042558	0.910	pteridine-containing compound metabolic process
GO:1901575	0.901	organic substance catabolic process
GO:1901565	0.884	organonitrogen compound catabolic process
GO:0006544	0.878	glycine metabolic process
GO:0006760	0.724	folic acid-containing compound metabolic process
GO:1901576	0.683	organic substance biosynthetic process
GO:0044249	0.678	cellular biosynthetic process
GO:1901566	0.570	organonitrogen compound biosynthetic process
GO:0046653	0.487	tetrahydrofolate metabolic process
GO:0044283	0.375	small molecule biosynthetic process
GO:0046394	0.343	carboxylic acid biosynthetic process
GO:0097164	0.321	ammonium ion metabolic process
GO:0046395	0.314	carboxylic acid catabolic process
GO:0009310	0.311	amine catabolic process
GO:1901607	0.302	alpha-amino acid biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070013	0.999	intracellular organelle lumen
GO:0005739	0.999	mitochondrion
GO:0005759	0.994	mitochondrial matrix
GO:0005829	0.464	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.5.8.-	1.000	With a flavin as acceptor.
RHEA:19793	0.936	(6S)-5,6,7,8-tetrahydrofolyl-(gamma-L-Glu)(n) + H(+) + oxidized [electron-transfer flavoprotein] + sarcosine = (6R)-5,10-methylenetetrahydrofolyl-(gamma-L-Glu)(n) + glycine + reduced [electron-transfer flavoprotein]
EC:1.5.8.3	0.936	sarcosine dehydrogenase.

[back to server]